CRUDIOS
magnet, attract, magnetic, pull, force, u magnet, magnetism, connection, sticky, physics tool, drag, snap, affinity, gravity, magnetic field, ios utility, android utility, material symbol, engagement, conversion, behavior, automation trigger - css.gg Icons - CgMagnet - SVG | WEBP | PNG | JPG - Icon free download
cg/CgMagnet

cg/CgMagnet (css.gg Icons)

VS Code
1import { CgMagnet } from "react-icons/cg";
2
3export default function Page(){
4  return <div><CgMagnet/></div>
5}
Click To Copy (Free To Use)
Description
Line-style magnet icon symbolizing attraction, pull, and magnetic force, ideal for marketing engagement indicators, physics-related interfaces, automation triggers, drag-and-snap UI actions, and features involving affinity or object grouping behaviors.
Tags
magnetattractmagneticpullforceu magnetmagnetismconnectionstickyphysics tooldragsnapaffinitygravitymagnetic fieldios utilityandroid utilitymaterial symbolengagementconversionbehaviorautomation trigger
Categories
symbolsscienceutilitiesmiscphysicstoolsmarketingattractionautomationproductivity
WEBP Download (256px)Customize & Download (HD)
Related Icons
funnel, plot, chart, analysis, data, conversion - Ant Design Icons - AiFillFunnelPlot - SVG | WEBP | PNG | JPG - Icon free download
AiFillFunnelPlot
pushpin, pin, attach, sticky, marker, bookmark - Ant Design Icons - AiFillPushpin - SVG | WEBP | PNG | JPG - Icon free download
AiFillPushpin
signal, network, wifi, strength, connection, bar, status - Ant Design Icons - AiFillSignal - SVG | WEBP | PNG | JPG - Icon free download
AiFillSignal
drag, handle, move, reorder, sort, ui-control - Ant Design Icons - AiOutlineDrag - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDrag
funnel, plot, chart, data, conversion, analytics, flow - Ant Design Icons - AiOutlineFunnelPlot - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFunnelPlot
gateway, network, router, connection, bridge, api - Ant Design Icons - AiOutlineGateway - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineGateway
holder, drag, handle, reorder, move, grid, list - Ant Design Icons - AiOutlineHolder - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineHolder
one-to-one, ratio, chat, direct, single, mapping, connection - Ant Design Icons - AiOutlineOneToOne - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineOneToOne
pull, request, merge, code, github, version control - Ant Design Icons - AiOutlinePullRequest - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePullRequest
pin, pushpin, bookmark, mark, sticky, note, attach - Ant Design Icons - AiOutlinePushpin - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePushpin
wifi, wireless, network, internet, connection, signal - Ant Design Icons - AiOutlineWifi - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineWifi
magnet, magnetic, attract, force, tool, pull - BoxIcons - BiMagnet - SVG | WEBP | PNG | JPG - Icon free download
BiMagnet
move, horizontal, drag, slide, left, right, adjust - BoxIcons - BiMoveHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BiMoveHorizontal
move, vertical, drag, slide, up, down, adjust - BoxIcons - BiMoveVertical - SVG | WEBP | PNG | JPG - Icon free download
BiMoveVertical
move, drag, arrows, cursor, resize, direction - BoxIcons - BiMove - SVG | WEBP | PNG | JPG - Icon free download
BiMove
wifi, signal, network, wireless, connection, internet - BoxIcons - BiWifi - SVG | WEBP | PNG | JPG - Icon free download
BiWifi
magnet, attract, magnetic, force, tool, physics - BoxIcons - BiSolidMagnet - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMagnet
snapchat, snap, story, camera, friends, chat - BoxIcons - BiLogoSnapchat - SVG | WEBP | PNG | JPG - Icon free download
BiLogoSnapchat
magnet, attract, magnetic, pull, force, physics, metal - Bootstrap Icons - BsFillMagnetFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMagnetFill
modem, internet, network, router, connection, hardware, signal - Bootstrap Icons - BsFillModemFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillModemFill
sticky, sticky-note, note, memo, post-it, reminder, pin, pinned, annotation, todo, task, organizer, widget, dashboard, collaboration, filled, svg, button, ui-element, stationery - Bootstrap Icons - BsFillStickyFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStickyFill
usb, mini, usb-mini, port, connector, plug, hardware, device, io, cable, data, transfer, charging, sync, peripheral, electronics, connection, interface, port-type, mobile-accessory, adapter, sidebar, footer, settings, toolbar - Bootstrap Icons - BsFillUsbMiniFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbMiniFill
usb, plug, usb-plug, connector, cable, hardware, device, io, peripheral, charging, sync, data-transfer, power, port, adapter, electronics, connection, wired, settings, toolbar, footer - Bootstrap Icons - BsFillUsbPlugFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbPlugFill
arrows, move, arrows-move, drag, reposition, cursor, move-tool, pan, shift, layout, grid, ui, interaction, pointer, android, ios, web - Bootstrap Icons - BsArrowsMove - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsMove
arrows, vertical, up-down, direction, scroll, resize, drag, movement, ui-control, navigation, layout-adjust, pointer - Bootstrap Icons - BsArrowsVertical - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsVertical
arrows, direction, multi-direction, navigate, pointer, move, drag, ui-control, layout, symbol - Bootstrap Icons - BsArrows - SVG | WEBP | PNG | JPG - Icon free download
BsArrows
bluetooth, wireless, connection, pair, device, network, mobile, tech, signal, connect, iot, transfer, communication, ui - Bootstrap Icons - BsBluetooth - SVG | WEBP | PNG | JPG - Icon free download
BsBluetooth
bounding, box, circles, bounding-box, transform, resize, drag, handles, editor, design, ui, element, crop, selection, move, frame, tool, graphics, hover - Bootstrap Icons - BsBoundingBoxCircles - SVG | WEBP | PNG | JPG - Icon free download
BsBoundingBoxCircles
bounding, box, bounding-box, frame, selection, crop, outline, design, editor, ui, graphics, positioning, drag, transform, move, resize, tool - Bootstrap Icons - BsBoundingBox - SVG | WEBP | PNG | JPG - Icon free download
BsBoundingBox
chat, right, heart, fill, chat-right, love, like, reaction, favorite, bubble, speech, message, support, appreciation, positive, engagement, messenger, sms, comment-react, reaction-icon - Bootstrap Icons - BsChatRightHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsChatRightHeartFill
chat, right, heart, chat-right, love, like, favorite, reaction, bubble, speech, message, comment-react, engagement, sms, messenger, reply, outline, expressive-ui - Bootstrap Icons - BsChatRightHeart - SVG | WEBP | PNG | JPG - Icon free download
BsChatRightHeart
chat, square, heart, filled, chat-square-heart, love, like, favorite, reaction, social, comment, message, bubble, ui, messaging, engagement, feedback - Bootstrap Icons - BsChatSquareHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquareHeartFill
chat, square, heart, chat-square-heart, love, like, favorite, reaction, message, bubble, comment, social, engagement, ui, messaging - Bootstrap Icons - BsChatSquareHeart - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquareHeart
exchange, currency-exchange, swap, convert, exchange-rate, forex, trading, finance, payment, transfer, conversion, economy, money, outline - Bootstrap Icons - BsCurrencyExchange - SVG | WEBP | PNG | JPG - Icon free download
BsCurrencyExchange
ethernet, network, lan, cable, connection, wired, router, internet, port, connectivity, hardware, outline, tech, iot - Bootstrap Icons - BsEthernet - SVG | WEBP | PNG | JPG - Icon free download
BsEthernet
grip, horizontal, drag, handle, ui, reorder, move, drag-handle, bars, dots, gesture, interaction, slider, resizable, touch, mobile, web, dragging, control - Bootstrap Icons - BsGripHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsGripHorizontal
grip, vertical, drag, handle, reorder, move, drag-handle, dots, bars, ui, gesture, interaction, touch, mobile, web, sort, draggable - Bootstrap Icons - BsGripVertical - SVG | WEBP | PNG | JPG - Icon free download
BsGripVertical
heart, fill, love, like, favorite, emotion, romance, valentine, reaction, positive, wishlist, save, icon-button, engagement, social-ui, feedback, symbol - Bootstrap Icons - BsHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsHeartFill
heart, outline, love, favorite, like, wishlist, reaction, romance, symbol, ui, social-feedback, positive, engagement - Bootstrap Icons - BsHeart - SVG | WEBP | PNG | JPG - Icon free download
BsHeart
magnet, attract, repel, magnetic, physics, force, science, tool, u-shape, magnetism, filled, grab, snap, drag, ui - Bootstrap Icons - BsMagnetFill - SVG | WEBP | PNG | JPG - Icon free download
BsMagnetFill
magnet, magnetic, attract, repel, physics, science, force, tool, outline, u-shape, magnetism, snap, drag, ui - Bootstrap Icons - BsMagnet - SVG | WEBP | PNG | JPG - Icon free download
BsMagnet
optical, audio, optical-audio, digital-audio, toslink, sound, speaker, media, music, cinema, home-theater, port, connection, filled, signal - Bootstrap Icons - BsOpticalAudioFill - SVG | WEBP | PNG | JPG - Icon free download
BsOpticalAudioFill
optical, audio, optical-audio, digital-audio, toslink, sound, speaker, media, music, connection, port, signal, outline, device-settings - Bootstrap Icons - BsOpticalAudio - SVG | WEBP | PNG | JPG - Icon free download
BsOpticalAudio
person, hearts, user, love, likes, favorites, affection, care, romance, relationship, engagement, avatar, social, bootstrap - Bootstrap Icons - BsPersonHearts - SVG | WEBP | PNG | JPG - Icon free download
BsPersonHearts
pin, marker, location, map-pin, attach, bookmark, note, pointer, pinboard, reminder, sticky, ui, menu, toolbar - Bootstrap Icons - BsPinFill - SVG | WEBP | PNG | JPG - Icon free download
BsPinFill
pin, thumbtack, tack, pushpin, sticky, marker, task, note, todo, reminder, attach, pin-item, pin-post, pin-message, ui, menu, button, sidebar - Bootstrap Icons - BsPin - SVG | WEBP | PNG | JPG - Icon free download
BsPin
signal, wifi, network, bars, strength, connectivity, cellular, status, indicator, connection, reception, mobile, wireless, ui, dashboard, line - Bootstrap Icons - BsSignal - SVG | WEBP | PNG | JPG - Icon free download
BsSignal
snapchat, snap, snapchat-logo, brand, social, social-network, messaging, stories, camera, share, profile, auth, oauth, social-icon, bootstrap, icon - Bootstrap Icons - BsSnapchat - SVG | WEBP | PNG | JPG - Icon free download
BsSnapchat
sticky, sticky-note, note, memo, reminder, filled, paper, document, tag, label, todo, task, planner, dashboard, ui - Bootstrap Icons - BsStickyFill - SVG | WEBP | PNG | JPG - Icon free download
BsStickyFill
sticky, note, sticky-note, memo, reminder, outline, paper, todo, task, planner, organizer, label, tag, ui - Bootstrap Icons - BsSticky - SVG | WEBP | PNG | JPG - Icon free download
BsSticky
textarea, resize, resize-handle, expand, shrink, input-field, form, text, editor, typing, ui, interaction, drag, corner, layout, ios, android, web - Bootstrap Icons - BsTextareaResize - SVG | WEBP | PNG | JPG - Icon free download
BsTextareaResize
usb, usb-fill, connector, plug, port, hardware, device, tech, data-transfer, charging, cable, peripheral, io, connection, usb-symbol, desktop, laptop, ios, android, interface, sidebar, toolbar, settings, system - Bootstrap Icons - BsUsbFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbFill
usb, usb-plug, connector, plug, port, cable, charging, data, hardware, device, tech, io, filled, settings, connection, accessory - Bootstrap Icons - BsUsbPlugFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbPlugFill
wifi, signal, wifi1, network, wireless, connection, internet, weak-signal, status, ui - Bootstrap Icons - BsWifi1 - SVG | WEBP | PNG | JPG - Icon free download
BsWifi1
wifi, signal, wireless, network, connection, internet, router, hotspot, online, connect, status, indicator, bars - Bootstrap Icons - BsWifi2 - SVG | WEBP | PNG | JPG - Icon free download
BsWifi2
wifi, signal, wireless, network, internet, router, hotspot, connection, online, bars, indicator, settings - Bootstrap Icons - BsWifi - SVG | WEBP | PNG | JPG - Icon free download
BsWifi
arrows, break, horizontal, split, divider, ui-control, navigate, drag, resize, layout, h-split, direction, left-right, horizontal-break - css.gg Icons - CgArrowsBreakeH - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsBreakeH
arrows, break, vertical, split, divider, ui-control, navigate, drag, resize, layout, v-split, direction, up-down, vertical-break - css.gg Icons - CgArrowsBreakeV - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsBreakeV
arrows, scroll, horizontal, h, drag, pan, move, navigate, ui-control - css.gg Icons - CgArrowsScrollH - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsScrollH
arrows, scroll, vertical, v, drag, pan, move, navigate, ui-action - css.gg Icons - CgArrowsScrollV - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsScrollV
arrows, shrink, horizontal, arrows-shrink-h, compress, collapse, resize, horizontal-resize, ui-control, layout, toolbar-action, button, interactive, drag, adjust, screen-fit - css.gg Icons - CgArrowsShrinkH - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsShrinkH
arrows, shrink, vertical, arrows-shrink-v, compress, collapse, resize, vertical-resize, ui-control, drag, adjust, fit, screen-adjust - css.gg Icons - CgArrowsShrinkV - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsShrinkV
arrows, vertical, alt, arrows-v-alt, up, down, scroll, move, navigate, drag, reorder, direction, ui-arrow, interaction - css.gg Icons - CgArrowsVAlt - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsVAlt
arrows, v, vertical, up-down, direction, scroll, move, drag, reorder, ui-arrow, indicator - css.gg Icons - CgArrowsV - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsV
crowdfire, brand, logo, social, media, marketing, automation, content, scheduler, app, platform, influencer, engagement, promotion, branding, social-media - css.gg Icons - CgCrowdfire - SVG | WEBP | PNG | JPG - Icon free download
CgCrowdfire
ethernet, lan, network cable, wired network, connection, port, internet, router, switch, infrastructure, hardware, signal, data, communication, technology, link, connector, cable, network device, wired - css.gg Icons - CgEthernet - SVG | WEBP | PNG | JPG - Icon free download
CgEthernet
git, pull, git pull, fetch, sync, merge, update, repository, repo, version control, vcs, source control, development, devops, engineering, workflow, sync code, collaboration, toolbar, nav, software - css.gg Icons - CgGitPull - SVG | WEBP | PNG | JPG - Icon free download
CgGitPull
heart, love, like, favorite, wishlist, emotion, reaction, social, care, health, romance, support, appreciation, rating, bookmark, ui feedback, engagement - css.gg Icons - CgHeart - SVG | WEBP | PNG | JPG - Icon free download
CgHeart
layout, pin, pinned, sticky, bookmark, save, remember, pinboard, priority, flag item, highlight, mark, ui pin, dashboard pin, fixed position, organize - css.gg Icons - CgLayoutPin - SVG | WEBP | PNG | JPG - Icon free download
CgLayoutPin
load, loadbar, doc, document, document upload, file, file upload, progress, upload queue, conversion, scan, batch upload, attachment, cms, admin panel, cloud storage, transfer, file manager, status, visual feedback, form attachment, ux, web ui, mobile ui, processing, document status, file processing, upload status, content management - css.gg Icons - CgLoadbarDoc - SVG | WEBP | PNG | JPG - Icon free download
CgLoadbarDoc
magnet, attract, magnetic, pull, force, u magnet, magnetism, connection, sticky, physics tool, drag, snap, affinity, gravity, magnetic field, ios utility, android utility, material symbol, engagement, conversion, behavior, automation trigger - css.gg Icons - CgMagnet - SVG | WEBP | PNG | JPG - Icon free download
CgMagnet
modem, network, router, internet, wifi, connection, broadband, ethernet, signal, lan, wan, device, hardware, iot, gateway, telecom, provider, network setup, bandwidth, data transfer - css.gg Icons - CgModem - SVG | WEBP | PNG | JPG - Icon free download
CgModem
pin top, pin, marker, location, place, anchor top, map pin, pointer, bookmark, fixed top, sticky, ui element, tag, highlight, note, organize, task - css.gg Icons - CgPinTop - SVG | WEBP | PNG | JPG - Icon free download
CgPinTop
pin, marker, map pin, location, point, place, tag, bookmark, save, note, highlight, pointer, organize, task, reminder, sticky, ui button, layout - css.gg Icons - CgPin - SVG | WEBP | PNG | JPG - Icon free download
CgPin
plug, power plug, connector, electric, socket, charge, charging, energy, power, cable, hardware, device, iot, connection, link, utility, settings, electronics, adapter, plugin, extension - css.gg Icons - CgPlug - SVG | WEBP | PNG | JPG - Icon free download
CgPlug
pull, clear, pull clear, reset, remove, erase, undo, swipe, gesture, action, interface, ui control, button, toolbar action, form reset, mobile ui, web ui, minimal icon, cssgg - css.gg Icons - CgPullClear - SVG | WEBP | PNG | JPG - Icon free download
CgPullClear
reorder, sort, drag, drag handle, move items, list order, arrange, organize, ui layout, sortable, list tools, menu reorder, sequence, priority list, stack edit - css.gg Icons - CgReorder - SVG | WEBP | PNG | JPG - Icon free download
CgReorder
scroll horizontal, horizontal scroll, scroll h, pan horizontal, drag, swipe, gesture, carousel, slider, timeline, movement, viewport, overflow, content navigation, ui control, arrows, scroll bar, touch interaction - css.gg Icons - CgScrollH - SVG | WEBP | PNG | JPG - Icon free download
CgScrollH
trending, trend, upward, growth, analytics, performance, chart, stats, popularity, hot, rise, arrow, dashboard, metric, insights, kpi, ranking, report, data, graph, indicator, boost, engagement - css.gg Icons - CgTrending - SVG | WEBP | PNG | JPG - Icon free download
CgTrending
twitter, brand, social, tweet, bird, microblog, social network, post, share, communication, x platform, follow, engagement, viral, social media, profile, feed, timeline, hashtags, community, marketing, promotion - css.gg Icons - CgTwitter - SVG | WEBP | PNG | JPG - Icon free download
CgTwitter
usb c, connector, type c, port, cable, charger, data transfer, hardware, plug, peripheral, connection, device io, laptop port, phone charging, high speed, usb type c - css.gg Icons - CgUsbC - SVG | WEBP | PNG | JPG - Icon free download
CgUsbC
cloud, storage, cloud icon, sync, backup, server, data, cloud storage, cloud computing, network, upload, download, connection, api, saas, hosting, infrastructure, web app, toolbar, button, nav, sidebar, system status, service - Circum Icons - CiCloud - SVG | WEBP | PNG | JPG - Icon free download
CiCloud
database, db, storage, server, data, dataset, warehouse, cloud db, backend, infrastructure, stack, query, sql, nosql, table, data center, admin, monitoring, analytics, system, devops, dashboard, schema, connection - Circum Icons - CiDatabase - SVG | WEBP | PNG | JPG - Icon free download
CiDatabase
heart, love, favorite, like, wishlist, emotion, valentine, romance, health, wellness, symbol, ui heart, outline heart, social action, engagement, reaction, button, icon, thin line, ios style, android style, minimal, clean - Circum Icons - CiHeart - SVG | WEBP | PNG | JPG - Icon free download
CiHeart
link, hyperlink, url, chain, connect, attach, anchor, navigate, open link, external link, internal link, button, share, reference, webpage, connection, clipboard, markdown link, editor, navigation control - Circum Icons - CiLink - SVG | WEBP | PNG | JPG - Icon free download
CiLink
plug, connector, power plug, electric, charging, charge, power, socket, cable, wire, electronics, adapter, energy, device connect, hardware, usb, link, connect, connection, power management, setup, configuration, electricity - Circum Icons - CiPlug1 - SVG | WEBP | PNG | JPG - Icon free download
CiPlug1
usb, connector, port, plug, peripheral, device, storage, flash drive, cable, connection, interface port, hardware, electronics, wired, tech, data transfer, adapter, symbol, io - Circum Icons - CiUsb - SVG | WEBP | PNG | JPG - Icon free download
CiUsb
wifi, wifi on, connected, online, signal, wireless, hotspot, network, strong signal, router, internet, status indicator, connection, pairing, available network, device, mobile, admin, header, footer, toolbar, icon, symbol, badge, ux, connect, wifi-available, network-success, hotspot-available - Circum Icons - CiWifiOn - SVG | WEBP | PNG | JPG - Icon free download
CiWifiOn
google analytics, ga, analytics, tracking, metrics, data, dashboard, charts, conversion, traffic, events, behavior, funnels, audience, web analytics, measurement, performance, reports, marketing, seo, ppc, insights, optimisation, tracking code, tag manager, platform, brand - Devicons - DiGoogleAnalytics - SVG | WEBP | PNG | JPG - Icon free download
DiGoogleAnalytics
accusoft, brand, logo, software, enterprise, ocr, document processing, pdf, cloud tools, api, developer tools, conversion, digital workflow, automation, tech, saas, vendor - Font Awesome 5 - FaAccusoft - SVG | WEBP | PNG | JPG - Icon free download
FaAccusoft
affiliatetheme, affiliate, theme, wordpress, ecommerce, blogging, affiliate marketing, brand, logo, monetization, seo, publisher, content marketing, affiliate tools, ads, conversion - Font Awesome 5 - FaAffiliatetheme - SVG | WEBP | PNG | JPG - Icon free download
FaAffiliatetheme
Tags
connectiondraguimovesignalnetworkarrowsengagement