CRUDIOS
presentation, slides, projector, screen, whiteboard, meeting, pitch, business, office, classroom, teach, demo, analytics, charts, report, briefing, workspace, productivity - css.gg Icons - CgPresentation - SVG | WEBP | PNG | JPG - Icon free download
cg/CgPresentation

cg/CgPresentation (css.gg Icons)

VS Code
1import { CgPresentation } from "react-icons/cg";
2
3export default function Page(){
4  return <div><CgPresentation/></div>
5}
Click To Copy (Free To Use)
Description
Line-style presentation icon depicting a projected slide board, suitable for business meetings, education platforms, analytics dashboards, and productivity tools featuring document or slide presentations.
Tags
presentationslidesprojectorscreenwhiteboardmeetingpitchbusinessofficeclassroomteachdemoanalyticschartsreportbriefingworkspaceproductivity
Categories
businessofficeproductivityeducationcommunicationpresentationanalytics
WEBP Download (256px)Customize & Download (HD)
Related Icons
boxplot, chart, stats, analytics, data, graph - Ant Design Icons - AiFillBoxPlot - SVG | WEBP | PNG | JPG - Icon free download
AiFillBoxPlot
pdf, file, document, report, download, viewer - Ant Design Icons - AiFillFilePdf - SVG | WEBP | PNG | JPG - Icon free download
AiFillFilePdf
ppt, presentation, slides, file, deck, powerpoint - Ant Design Icons - AiFillFilePpt - SVG | WEBP | PNG | JPG - Icon free download
AiFillFilePpt
file, word, document, doc, office, text - Ant Design Icons - AiFillFileWord - SVG | WEBP | PNG | JPG - Icon free download
AiFillFileWord
flag, mark, bookmark, report, indicator, tag - Ant Design Icons - AiFillFlag - SVG | WEBP | PNG | JPG - Icon free download
AiFillFlag
pie-chart, analytics, statistics, data, report, visualization - Ant Design Icons - AiFillPieChart - SVG | WEBP | PNG | JPG - Icon free download
AiFillPieChart
printer, print, hardcopy, device, print-job, office - Ant Design Icons - AiFillPrinter - SVG | WEBP | PNG | JPG - Icon free download
AiFillPrinter
project, task, roadmap, milestone, plan, workspace - Ant Design Icons - AiFillProject - SVG | WEBP | PNG | JPG - Icon free download
AiFillProject
slack, brand, chat, team, workspace, circle, message, collab - Ant Design Icons - AiFillSlackCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillSlackCircle
slack, brand, chat, team, workspace, square, message, collab - Ant Design Icons - AiFillSlackSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillSlackSquare
tablet, device, screen, mobile, pad, touch, display - Ant Design Icons - AiFillTablet - SVG | WEBP | PNG | JPG - Icon free download
AiFillTablet
area, chart, graph, analytics, trend, outline - Ant Design Icons - AiOutlineAreaChart - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAreaChart
audit, review, report, check, finance, compliance - Ant Design Icons - AiOutlineAudit - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAudit
bar, chart, graph, stats, analytics, data, bars - Ant Design Icons - AiOutlineBarChart - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBarChart
desktop, monitor, screen, pc, display, computer, workstation - Ant Design Icons - AiOutlineDesktop - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDesktop
dot-chart, chart, graph, analytics, stats, trend, data - Ant Design Icons - AiOutlineDotChart - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDotChart
file, excel, spreadsheet, xls, sheet, document, office - Ant Design Icons - AiOutlineFileExcel - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFileExcel
file, pdf, document, report, print, reader, export - Ant Design Icons - AiOutlineFilePdf - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFilePdf
file, ppt, presentation, slides, document, office, deck - Ant Design Icons - AiOutlineFilePpt - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFilePpt
file, text, document, note, report, paper, content - Ant Design Icons - AiOutlineFileText - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFileText
file, word, doc, document, office, text, microsoft - Ant Design Icons - AiOutlineFileWord - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFileWord
fullscreen, exit, screen, close, view, window, shrink - Ant Design Icons - AiOutlineFullscreenExit - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFullscreenExit
fullscreen, expand, screen, view, window, maximize - Ant Design Icons - AiOutlineFullscreen - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFullscreen
fund, projection, screen, chart, presentation, finance, report - Ant Design Icons - AiOutlineFundProjectionScreen - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFundProjectionScreen
funnel, plot, chart, data, conversion, analytics, flow - Ant Design Icons - AiOutlineFunnelPlot - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFunnelPlot
heatmap, data, visualization, density, analytics, chart, map - Ant Design Icons - AiOutlineHeatMap - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineHeatMap
line, chart, graph, analytics, trend, stats, data - Ant Design Icons - AiOutlineLineChart - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLineChart
linkedin, social, network, profile, business, brand, connect - Ant Design Icons - AiOutlineLinkedin - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLinkedin
mobile, phone, smartphone, device, handheld, screen, responsive - Ant Design Icons - AiOutlineMobile - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMobile
monitor, screen, display, desktop, computer, view, window - Ant Design Icons - AiOutlineMonitor - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMonitor
pie, chart, analytics, stats, report, graph, data - Ant Design Icons - AiOutlinePieChart - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePieChart
printer, print, document, paper, office, device, output - Ant Design Icons - AiOutlinePrinter - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePrinter
rise, growth, increase, up, trend, chart, analytics - Ant Design Icons - AiOutlineRise - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineRise
slack, chat, team, collaboration, brand, workspace - Ant Design Icons - AiOutlineSlack - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSlack
tablet, device, mobile, screen, electronics, touch, display - Ant Design Icons - AiOutlineTablet - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTablet
wechat, work, enterprise, chat, messaging, business - Ant Design Icons - AiOutlineWechatWork - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineWechatWork
box plot, chart, statistics, data, analytics, graph - Ant Design Icons - AiTwotoneBoxPlot - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneBoxPlot
container, document, file, folder, storage, system, box, business - Ant Design Icons - AiTwotoneContainer - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneContainer
copyright, circle, legal, symbol, trademark, rights, business, intellectual - Ant Design Icons - AiTwotoneCopyrightCircle - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCopyrightCircle
copyright, legal, symbol, rights, trademark, business, license, intellectual - Ant Design Icons - AiTwotoneCopyright - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCopyright
excel, file, sheet, xlsx, spreadsheet, document, office - Ant Design Icons - AiTwotoneFileExcel - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneFileExcel
file, pdf, document, report, export, read, format - Ant Design Icons - AiTwotoneFilePdf - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneFilePdf
file, ppt, presentation, slides, document, office, format - Ant Design Icons - AiTwotoneFilePpt - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneFilePpt
file, word, doc, document, office, text, format - Ant Design Icons - AiTwotoneFileWord - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneFileWord
funnel, plot, chart, graph, report, analytics - Ant Design Icons - AiTwotoneFunnelPlot - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneFunnelPlot
pie, chart, analytics, stats, data, report, graph - Ant Design Icons - AiTwotonePieChart - SVG | WEBP | PNG | JPG - Icon free download
AiTwotonePieChart
printer, print, document, paper, office, device, hardware - Ant Design Icons - AiTwotonePrinter - SVG | WEBP | PNG | JPG - Icon free download
AiTwotonePrinter
tablet, device, screen, mobile, touch, display - Ant Design Icons - AiTwotoneTablet - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneTablet
analyse, chart, inspect, data, report, metrics - BoxIcons - BiAnalyse - SVG | WEBP | PNG | JPG - Icon free download
BiAnalyse
area, chart, graph, analytics, data, plot - BoxIcons - BiArea - SVG | WEBP | PNG | JPG - Icon free download
BiArea
bar-chart, chart, stats, analytics, metrics, graph - BoxIcons - BiBarChartAlt2 - SVG | WEBP | PNG | JPG - Icon free download
BiBarChartAlt2
bar-chart, chart, analytics, stats, graph, metrics - BoxIcons - BiBarChartAlt - SVG | WEBP | PNG | JPG - Icon free download
BiBarChartAlt
bar-chart, square-chart, stats, analytics, data, graph - BoxIcons - BiBarChartSquare - SVG | WEBP | PNG | JPG - Icon free download
BiBarChartSquare
bar-chart, chart, graph, analytics, stats, data - BoxIcons - BiBarChart - SVG | WEBP | PNG | JPG - Icon free download
BiBarChart
briefcase, bag, work, office, business, job, portfolio - BoxIcons - BiBriefcaseAlt2 - SVG | WEBP | PNG | JPG - Icon free download
BiBriefcaseAlt2
briefcase, work, office, business, job, portfolio, career - BoxIcons - BiBriefcaseAlt - SVG | WEBP | PNG | JPG - Icon free download
BiBriefcaseAlt
briefcase, business, work, job, office, portfolio, career - BoxIcons - BiBriefcase - SVG | WEBP | PNG | JPG - Icon free download
BiBriefcase
brightness, half, light, adjust, display, screen, mode - BoxIcons - BiBrightnessHalf - SVG | WEBP | PNG | JPG - Icon free download
BiBrightnessHalf
brightness, light, sun, adjust, display, screen, mode - BoxIcons - BiBrightness - SVG | WEBP | PNG | JPG - Icon free download
BiBrightness
building, office, company, structure, property, organization - BoxIcons - BiBuilding - SVG | WEBP | PNG | JPG - Icon free download
BiBuilding
cabinet, drawer, storage, furniture, office, files, organizer - BoxIcons - BiCabinet - SVG | WEBP | PNG | JPG - Icon free download
BiCabinet
calculator, math, count, numbers, finance, compute, office - BoxIcons - BiCalculator - SVG | WEBP | PNG | JPG - Icon free download
BiCalculator
cast, stream, screen, wifi, mirror, broadcast - BoxIcons - BiCast - SVG | WEBP | PNG | JPG - Icon free download
BiCast
chair, seat, furniture, sit, office, home - BoxIcons - BiChair - SVG | WEBP | PNG | JPG - Icon free download
BiChair
chalkboard, board, class, teach, school, presentation - BoxIcons - BiChalkboard - SVG | WEBP | PNG | JPG - Icon free download
BiChalkboard
chart, graph, stats, data, analytics, report - BoxIcons - BiChart - SVG | WEBP | PNG | JPG - Icon free download
BiChart
data, dataset, stats, analytics, info, table, dashboard - BoxIcons - BiData - SVG | WEBP | PNG | JPG - Icon free download
BiData
desktop, monitor, screen, computer, pc, workstation, device - BoxIcons - BiDesktop - SVG | WEBP | PNG | JPG - Icon free download
BiDesktop
doughnut, chart, analytics, graph, stats, data - BoxIcons - BiDoughnutChart - SVG | WEBP | PNG | JPG - Icon free download
BiDoughnutChart
exit, fullscreen, collapse, close, screen, resize, ui - BoxIcons - BiExitFullscreen - SVG | WEBP | PNG | JPG - Icon free download
BiExitFullscreen
flag, marker, report, label, indicator, bookmark, notify - BoxIcons - BiFlag - SVG | WEBP | PNG | JPG - Icon free download
BiFlag
fullscreen, expand, view, screen, maximize, display - BoxIcons - BiFullscreen - SVG | WEBP | PNG | JPG - Icon free download
BiFullscreen
chart, line, stats, graph, trend, analytics, data - BoxIcons - BiLineChart - SVG | WEBP | PNG | JPG - Icon free download
BiLineChart
mobile, alt, phone, smartphone, device, call, screen - BoxIcons - BiMobileAlt - SVG | WEBP | PNG | JPG - Icon free download
BiMobileAlt
mobile, landscape, phone, rotate, orientation, device, screen - BoxIcons - BiMobileLandscape - SVG | WEBP | PNG | JPG - Icon free download
BiMobileLandscape
mobile, phone, smartphone, device, call, screen, communication - BoxIcons - BiMobile - SVG | WEBP | PNG | JPG - Icon free download
BiMobile
news, article, headline, report, feed, paper - BoxIcons - BiNews - SVG | WEBP | PNG | JPG - Icon free download
BiNews
pie, chart, analytics, stats, report, data - BoxIcons - BiPieChartAlt2 - SVG | WEBP | PNG | JPG - Icon free download
BiPieChartAlt2
pie, chart, analytics, statistics, data, insights - BoxIcons - BiPieChartAlt - SVG | WEBP | PNG | JPG - Icon free download
BiPieChartAlt
pie, chart, analytics, stats, dashboard, report - BoxIcons - BiPieChart - SVG | WEBP | PNG | JPG - Icon free download
BiPieChart
printer, print, document, paper, office, hardware - BoxIcons - BiPrinter - SVG | WEBP | PNG | JPG - Icon free download
BiPrinter
scatter, chart, graph, data, analytics, points, stats - BoxIcons - BiScatterChart - SVG | WEBP | PNG | JPG - Icon free download
BiScatterChart
screenshot, capture, screen, snapshot, image, tool, interface - BoxIcons - BiScreenshot - SVG | WEBP | PNG | JPG - Icon free download
BiScreenshot
slideshow, presentation, slides, gallery, image, play - BoxIcons - BiSlideshow - SVG | WEBP | PNG | JPG - Icon free download
BiSlideshow
stats, statistics, graph, chart, analytics, data, report - BoxIcons - BiStats - SVG | WEBP | PNG | JPG - Icon free download
BiStats
trending, down, decline, graph, chart, drop, analytics, market - BoxIcons - BiTrendingDown - SVG | WEBP | PNG | JPG - Icon free download
BiTrendingDown
trending, up, growth, increase, graph, chart, rise, analytics - BoxIcons - BiTrendingUp - SVG | WEBP | PNG | JPG - Icon free download
BiTrendingUp
tv, television, screen, display, monitor, media - BoxIcons - BiTv - SVG | WEBP | PNG | JPG - Icon free download
BiTv
window, ui, app, panel, screen, layout, alt-window - BoxIcons - BiWindowAlt - SVG | WEBP | PNG | JPG - Icon free download
BiWindowAlt
window, open, expand, ui, panel, screen - BoxIcons - BiWindowOpen - SVG | WEBP | PNG | JPG - Icon free download
BiWindowOpen
window, ui, panel, screen, layout, app - BoxIcons - BiWindow - SVG | WEBP | PNG | JPG - Icon free download
BiWindow
analyse, analytics, data, inspect, report, chart, overview - BoxIcons - BiSolidAnalyse - SVG | WEBP | PNG | JPG - Icon free download
BiSolidAnalyse
area, area-chart, chart, graph, analytics, statistics, region, metric - BoxIcons - BiSolidArea - SVG | WEBP | PNG | JPG - Icon free download
BiSolidArea
bar chart, chart, analytics, graph, stats, data, report - BoxIcons - BiSolidBarChartAlt2 - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBarChartAlt2
bar chart, square chart, analytics, data, statistics, graph - BoxIcons - BiSolidBarChartSquare - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBarChartSquare
briefcase, work, job, career, portfolio, office, business - BoxIcons - BiSolidBriefcaseAlt2 - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBriefcaseAlt2
briefcase, work, career, office, job, business, portfolio - BoxIcons - BiSolidBriefcaseAlt - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBriefcaseAlt
briefcase, business, work, office, career, job, portfolio - BoxIcons - BiSolidBriefcase - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBriefcase
brightness, half, light, display, screen, adjust, level - BoxIcons - BiSolidBrightnessHalf - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBrightnessHalf
brightness, light, display, screen, adjust, sun, level - BoxIcons - BiSolidBrightness - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBrightness
building, office, company, structure, property, real estate, tower - BoxIcons - BiSolidBuilding - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBuilding
business, company, office, building, work, corporate, enterprise - BoxIcons - BiSolidBusiness - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBusiness
cabinet, drawer, storage, files, organize, furniture, office - BoxIcons - BiSolidCabinet - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCabinet
calendar, event, schedule, planner, date, meeting, agenda - BoxIcons - BiSolidCalendarEvent - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCalendarEvent
chalkboard, board, teaching, classroom, lesson, school - BoxIcons - BiSolidChalkboard - SVG | WEBP | PNG | JPG - Icon free download
BiSolidChalkboard
chart, graph, stats, analytics, report, data - BoxIcons - BiSolidChart - SVG | WEBP | PNG | JPG - Icon free download
BiSolidChart
dashboard, panel, stats, overview, control, analytics - BoxIcons - BiSolidDashboard - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDashboard
data, database, info, records, storage, analytics - BoxIcons - BiSolidData - SVG | WEBP | PNG | JPG - Icon free download
BiSolidData
doughnut, chart, analytics, data, graph, stats, report - BoxIcons - BiSolidDoughnutChart - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDoughnutChart
file, doc, document, word, text, office - BoxIcons - BiSolidFileDoc - SVG | WEBP | PNG | JPG - Icon free download
BiSolidFileDoc
institution, building, government, school, office, organization - BoxIcons - BiSolidInstitution - SVG | WEBP | PNG | JPG - Icon free download
BiSolidInstitution
news, article, headline, feed, update, press, report - BoxIcons - BiSolidNews - SVG | WEBP | PNG | JPG - Icon free download
BiSolidNews
pie, chart, analytics, stats, data, graph, report - BoxIcons - BiSolidPieChartAlt2 - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPieChartAlt2
pie, chart, analytics, data, graph, stats, report - BoxIcons - BiSolidPieChartAlt - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPieChartAlt
pie, chart, analytics, data, report, stats, graph - BoxIcons - BiSolidPieChart - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPieChart
printer, print, device, paper, document, office, output - BoxIcons - BiSolidPrinter - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPrinter
report, document, analysis, file, summary, review - BoxIcons - BiSolidReport - SVG | WEBP | PNG | JPG - Icon free download
BiSolidReport
slideshow, presentation, images, gallery, display, media - BoxIcons - BiSolidSlideshow - SVG | WEBP | PNG | JPG - Icon free download
BiSolidSlideshow
store, shop, market, retail, commerce, storefront, business - BoxIcons - BiSolidStore - SVG | WEBP | PNG | JPG - Icon free download
BiSolidStore
tv, television, screen, display, monitor, media - BoxIcons - BiSolidTv - SVG | WEBP | PNG | JPG - Icon free download
BiSolidTv
window, alt, app, panel, screen, ui - BoxIcons - BiSolidWindowAlt - SVG | WEBP | PNG | JPG - Icon free download
BiSolidWindowAlt
linkedin, square, network, profile, business, social, connect - BoxIcons - BiLogoLinkedinSquare - SVG | WEBP | PNG | JPG - Icon free download
BiLogoLinkedinSquare
teams, microsoft, chat, video, meeting, collaboration - BoxIcons - BiLogoMicrosoftTeams - SVG | WEBP | PNG | JPG - Icon free download
BiLogoMicrosoftTeams
microsoft, windows, company, software, brand, office - BoxIcons - BiLogoMicrosoft - SVG | WEBP | PNG | JPG - Icon free download
BiLogoMicrosoft
slack, team, chat, workspace, messages, old - BoxIcons - BiLogoSlackOld - SVG | WEBP | PNG | JPG - Icon free download
BiLogoSlackOld
slack, team, chat, workspace, messages, collab - BoxIcons - BiLogoSlack - SVG | WEBP | PNG | JPG - Icon free download
BiLogoSlack
xing, network, professional, career, jobs, profiles, business - BoxIcons - BiLogoXing - SVG | WEBP | PNG | JPG - Icon free download
BiLogoXing
yelp, review, ratings, business, brand, social - BoxIcons - BiLogoYelp - SVG | WEBP | PNG | JPG - Icon free download
BiLogoYelp
zoom, video, meeting, conference, brand, call - BoxIcons - BiLogoZoom - SVG | WEBP | PNG | JPG - Icon free download
BiLogoZoom
bar, chart, analytics, stats, data, graph - Bootstrap Icons - BsFillBarChartFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBarChartFill
bar, chart, line, data, stats, graph, analytics - Bootstrap Icons - BsFillBarChartLineFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBarChartLineFill
briefcase, work, business, job, portfolio, career - Bootstrap Icons - BsFillBriefcaseFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBriefcaseFill
brightness, high, alt, light, screen, display, sun, level - Bootstrap Icons - BsFillBrightnessAltHighFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBrightnessAltHighFill
brightness, low, alt, light, dim, screen, display, level - Bootstrap Icons - BsFillBrightnessAltLowFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBrightnessAltLowFill
brightness, high, light, screen, display, sun, level, adjust - Bootstrap Icons - BsFillBrightnessHighFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBrightnessHighFill
brightness, low, dim, light, screen, display, level, adjust - Bootstrap Icons - BsFillBrightnessLowFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBrightnessLowFill
building, office, company, structure, city, tower, workplace, establishment - Bootstrap Icons - BsFillBuildingFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBuildingFill
calendar, event, meeting, planner, schedule, appointment - Bootstrap Icons - BsFillCalendarEventFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCalendarEventFill
clipboard, data, chart, info, report, document, stats - Bootstrap Icons - BsFillClipboardDataFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillClipboardDataFill
clipboard, data, report, chart, info, stats, document - Bootstrap Icons - BsFillClipboard2DataFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillClipboard2DataFill
diagram, flow, chart, graph, analytics, structure - Bootstrap Icons - BsFillDiagram2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDiagram2Fill
diagram, flow, tree, chart, analytics, structure - Bootstrap Icons - BsFillDiagram3Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDiagram3Fill
display, monitor, screen, desktop, computer, device - Bootstrap Icons - BsFillDisplayFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDisplayFill
easel, board, presentation, art, display, teaching - Bootstrap Icons - BsFillEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillEaselFill
easel, board, presentation, art, drawing, display - Bootstrap Icons - BsFillEasel2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillEasel2Fill
easel, board, presentation, art, creative, display - Bootstrap Icons - BsFillEasel3Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillEasel3Fill
file, bar-graph, chart, analytics, report, stats - Bootstrap Icons - BsFillFileBarGraphFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileBarGraphFill
file, earmark, bar-graph, chart, report, stats - Bootstrap Icons - BsFillFileEarmarkBarGraphFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkBarGraphFill
file, easel, presentation, board, teaching, document, slide - Bootstrap Icons - BsFillFileEarmarkEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkEaselFill
file, medical, health, report, document, hospital, record - Bootstrap Icons - BsFillFileEarmarkMedicalFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkMedicalFill
file, pdf, document, acrobat, report, form, read - Bootstrap Icons - BsFillFileEarmarkPdfFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkPdfFill
file, ppt, powerpoint, slides, presentation, document, deck - Bootstrap Icons - BsFillFileEarmarkPptFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkPptFill
file, slides, presentation, deck, ppt, document, teaching - Bootstrap Icons - BsFillFileEarmarkSlidesFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkSlidesFill
file, word, doc, document, writing, editor, report - Bootstrap Icons - BsFillFileEarmarkWordFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkWordFill
file, easel, presentation, board, teacher, document, lecture - Bootstrap Icons - BsFillFileEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEaselFill
file, excel, sheet, xls, spreadsheet, document, office - Bootstrap Icons - BsFillFileExcelFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileExcelFill
file, medical, health, report, clinic, document - Bootstrap Icons - BsFillFileMedicalFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileMedicalFill
file, ppt, presentation, slides, powerpoint, document - Bootstrap Icons - BsFillFilePptFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFilePptFill
file, slides, presentation, deck, ppt, document - Bootstrap Icons - BsFillFileSlidesFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileSlidesFill
file, word, doc, document, office, writer - Bootstrap Icons - BsFillFileWordFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileWordFill
lamp, light, desk, illumination, bulb, home, workspace - Bootstrap Icons - BsFillLampFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillLampFill
phone, landscape, rotate, orientation, mobile, device, screen - Bootstrap Icons - BsFillPhoneLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPhoneLandscapeFill
pie, chart, analytics, stats, data, graph, report - Bootstrap Icons - BsFillPieChartFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPieChartFill
printer, print, device, paper, office, document, hardware - Bootstrap Icons - BsFillPrinterFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPrinterFill
projector, presentation, screen, display, video, device, project - Bootstrap Icons - BsFillProjectorFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillProjectorFill
stickies, sticky-notes, notes, memo, post-it, reminder, note-stack, note-board, task, todo, workspace, dashboard, widget, panel, collaboration, annotation, pinned, organizer, productivity, ui-element, button, svg, filled, stationery - Bootstrap Icons - BsFillStickiesFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStickiesFill
suitcase, luggage, bag, travel, briefcase, business, trip, packing, baggage, travel-booking, airport, hotel, work, commute, filled, svg, checkout, shipping, icon, ui-element - Bootstrap Icons - BsFillSuitcaseFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSuitcaseFill
suitcase-2, suitcase, luggage, bag, carry-on, travel, briefcase, business, trip, packing, baggage, vacation, airport, filled, svg, tourism, icon, ui-element - Bootstrap Icons - BsFillSuitcase2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSuitcase2Fill
tablet, device, mobile, screen, touchscreen, electronics, gadget, smart-device, ipad, android-tablet, responsive, layout, interface, technology, media-device - Bootstrap Icons - BsFillTabletFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTabletFill
tablet, landscape, device, horizontal, screen, touchscreen, electronics, responsive, orientation, media, ipad, android-tablet, layout, interface - Bootstrap Icons - BsFillTabletLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTabletLandscapeFill
tv, television, screen, monitor, display, media, video, entertainment, electronics, device, smart-tv, home, ui - Bootstrap Icons - BsFillTvFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTvFill
webcam, camera, video, stream, live, record, conference, meeting, call, online-class, monitoring, security-cam, device, hardware, lens, capture, broadcast, chat, video-call, toolbar - Bootstrap Icons - BsFillWebcamFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillWebcamFill
activity, heartbeat, pulse, monitor, analytics, chart, signal, graph, tracking, performance, health, status, monitoring, metric - Bootstrap Icons - BsActivity - SVG | WEBP | PNG | JPG - Icon free download
BsActivity
arrows, fullscreen, expand, maximize, full-screen, screen, display, ui, player, video, view, enlarge, panel, window, android, ios, web - Bootstrap Icons - BsArrowsFullscreen - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsFullscreen
bar, chart, barchart, bar-chart, analytics, data, statistics, reports, dashboard, filled, visualization, metrics, performance, insights, ui, web, mobile, bootstrap - Bootstrap Icons - BsBarChartFill - SVG | WEBP | PNG | JPG - Icon free download
BsBarChartFill
bar, chart, line, bar-chart-line, analytics, data, statistics, trend, reports, dashboard, filled, visualization, metrics, insights, ui, web, mobile, bootstrap - Bootstrap Icons - BsBarChartLineFill - SVG | WEBP | PNG | JPG - Icon free download
BsBarChartLineFill
bar, chart, line, bar-chart-line, analytics, data, statistics, trend, reports, dashboard, outline, visualization, metrics, insights, ui, web, mobile, bootstrap - Bootstrap Icons - BsBarChartLine - SVG | WEBP | PNG | JPG - Icon free download
BsBarChartLine
bar, chart, steps, bar-chart-steps, analytics, progress, milestones, statistics, dashboard, outline, visualization, metrics, ui, web, mobile, bootstrap - Bootstrap Icons - BsBarChartSteps - SVG | WEBP | PNG | JPG - Icon free download
BsBarChartSteps
bar, chart, bar-chart, analytics, data, statistics, reports, dashboard, outline, visualization, metrics, performance, insights, ui, web, mobile, bootstrap - Bootstrap Icons - BsBarChart - SVG | WEBP | PNG | JPG - Icon free download
BsBarChart
briefcase, work, job, career, office, business, portfolio, professional, employment, documents, business-tools, task, corporate - Bootstrap Icons - BsBriefcaseFill - SVG | WEBP | PNG | JPG - Icon free download
BsBriefcaseFill
briefcase, work, job, career, office, business, portfolio, professional, employment, documents, task, corporate - Bootstrap Icons - BsBriefcase - SVG | WEBP | PNG | JPG - Icon free download
BsBriefcase
brightness, high, sun, light, display, screen, settings, contrast, visibility, level, ui-control, adjustment, day-mode - Bootstrap Icons - BsBrightnessAltHighFill - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessAltHighFill
brightness, high, sun, light, display, screen, settings, contrast, visibility, day-mode, ui-control, icon-outline - Bootstrap Icons - BsBrightnessAltHigh - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessAltHigh
brightness, low, sun, dim, light, display, screen, settings, contrast, night-mode, level, adjustment - Bootstrap Icons - BsBrightnessAltLowFill - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessAltLowFill
brightness, low, sun, dim, light, display, screen, settings, contrast, night-mode, ui-control - Bootstrap Icons - BsBrightnessAltLow - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessAltLow
brightness, high, light, sun, display, screen, settings, contrast, day-mode, adjustment - Bootstrap Icons - BsBrightnessHighFill - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessHighFill
brightness, high, light, sun, display, screen, settings, contrast, day-mode, ui-control - Bootstrap Icons - BsBrightnessHigh - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessHigh
brightness, low, dim, light, sun, display, screen, settings, contrast, adjustment, night-mode - Bootstrap Icons - BsBrightnessLowFill - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessLowFill
brightness, low, dim, sun, light, display, screen, settings, contrast, ui-control - Bootstrap Icons - BsBrightnessLow - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessLow
brilliance, brightness, shine, glow, light, illumination, display, screen, settings, contrast, ui-adjustment - Bootstrap Icons - BsBrilliance - SVG | WEBP | PNG | JPG - Icon free download
BsBrilliance
building, add, new-building, create, infrastructure, construction, real-estate, office, facilities, city, urban, property, management, structure - Bootstrap Icons - BsBuildingAdd - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingAdd
building, check, verified, approved, real-estate, infrastructure, property, inspection, audit, office, city, management, compliance - Bootstrap Icons - BsBuildingCheck - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingCheck
building, dash, remove, minus, reduce, infrastructure, property, management, facility, structure, city, office - Bootstrap Icons - BsBuildingDash - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingDash
building, down, collapse, decline, infrastructure, status, facility, property, office, city, falling, downgrade - Bootstrap Icons - BsBuildingDown - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingDown
building, exclamation, alert, warning, risk, danger, issue, property, facility, infrastructure, office, city - Bootstrap Icons - BsBuildingExclamation - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingExclamation
building, add, filled-building, new, create, infrastructure, real-estate, property, city, office, facility, urban - Bootstrap Icons - BsBuildingFillAdd - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillAdd
building, check, verified, approval, filled-building, property, inspection, real-estate, compliance, office, city - Bootstrap Icons - BsBuildingFillCheck - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillCheck
building, dash, remove, minus, deactivate, filled-building, property, office, city, infrastructure - Bootstrap Icons - BsBuildingFillDash - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillDash
building, down, decline, drop, filled-building, property, city, analytics, infrastructure, downgrade - Bootstrap Icons - BsBuildingFillDown - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillDown
building, gear, settings, filled-building, configuration, property, infrastructure, maintenance, office, management - Bootstrap Icons - BsBuildingFillGear - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillGear
building, lock, security, filled-building, access, restricted, property, infrastructure, office, safety - Bootstrap Icons - BsBuildingFillLock - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillLock
building, slash, restricted, forbidden, disable, filled-building, property, office, city, no-access - Bootstrap Icons - BsBuildingFillSlash - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillSlash
building, x, remove, close, delete, filled-building, property, city, infrastructure, office - Bootstrap Icons - BsBuildingFillX - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillX
building, office, tower, skyscraper, city, structure, real-estate, property, headquarters, enterprise, company, location, map, urban, infrastructure, block, complex, estate, landmark, navigation, ui, header, sidebar, button - Bootstrap Icons - BsBuildingFill - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFill
building, up, growth, increase, upgrade, expansion, rise, progress, city, property, development, elevation, improvement, boost, enhancement, advancement, real-estate-growth, analytics - Bootstrap Icons - BsBuildingUp - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingUp
building, office, tower, structure, city, urban, company, real-estate, property, location, map, landmark, enterprise, infrastructure, estate, headquarters - Bootstrap Icons - BsBuilding - SVG | WEBP | PNG | JPG - Icon free download
BsBuilding
calculator, math, arithmetic, numbers, finance, accounting, audit, tax, calculation, compute, cost, estimate, business, ledger, analysis, filled, ui, toolbar, button, schools, office, formula, equations - Bootstrap Icons - BsCalculatorFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalculatorFill
calculator, math, arithmetic, numbers, finance, accounting, audit, tax, calculation, compute, cost, estimate, business, analysis, outline, ui, toolbar, button, formula, equations, school, office - Bootstrap Icons - BsCalculator - SVG | WEBP | PNG | JPG - Icon free download
BsCalculator
calendar, check, calendar-check, event, task, todo, completed, done, schedule, appointment, booking, deadline, filled, ui, planner, reminder, meeting, success, confirmation, tick - Bootstrap Icons - BsCalendarCheckFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarCheckFill
calendar, check, calendar-check, event, task, todo, completed, done, schedule, appointment, booking, deadline, outline, ui, planner, meeting, reminder, success, confirmation, tick - Bootstrap Icons - BsCalendarCheck - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarCheck
calendar, event, calendar-event, schedule, meeting, appointment, booking, reminder, filled, ui, planner, deadline, conference, task, agenda, notification - Bootstrap Icons - BsCalendarEventFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarEventFill
calendar, event, calendar-event, schedule, appointment, meeting, planner, date, reminder, timeline, agenda, work, task, booking, ui, header, toolbar, icon, outline, month-view, day-view - Bootstrap Icons - BsCalendarEvent - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarEvent
calendar, event, calendar3, filled, schedule, planner, date, meeting, appointment, booking, ui, ux, bootstrap - Bootstrap Icons - BsCalendar3EventFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3EventFill
calendar, calendar3, event, calendar-event, schedule, date, day, appointment, meeting, planner, timeline, agenda, reminder, booking, ui, ux, toolbar, menu, button, header, footer, nav, ios, android, webapp - Bootstrap Icons - BsCalendar3Event - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3Event
calendar, calendar3, week, weekly, outline, planner, agenda, schedule, date, timeline, ui, ux, webapp, toolbar, meeting, events - Bootstrap Icons - BsCalendar3Week - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3Week
calendar, calendar4, event, calendar-event, schedule, meeting, appointment, planner, timeline, agenda, booking, ui, ux, toolbar, date - Bootstrap Icons - BsCalendar4Event - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar4Event
calendar, calendar4, week, weekly, weekly-view, planner, agenda, schedule, timeline, ui, ux, toolbar, date, meeting - Bootstrap Icons - BsCalendar4Week - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar4Week
calendar, calendar4, date, day, month, year, schedule, event, planner, agenda, booking, appointments, timeline, reminder, ui, navbar, toolbar, button, sidebar, productivity, office - Bootstrap Icons - BsCalendar4 - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar4
camera, video, off, disabled, no-video, camera-video-off-fill, mute-video, stop-video, record-off, privacy, offline, status, webcam-off, meeting, call, ui - Bootstrap Icons - BsCameraVideoOffFill - SVG | WEBP | PNG | JPG - Icon free download
BsCameraVideoOffFill
camera, video, off, camera-video-off, disable, mute-video, no-camera, privacy, webcam, call, meeting, conference, ui, toolbar - Bootstrap Icons - BsCameraVideoOff - SVG | WEBP | PNG | JPG - Icon free download
BsCameraVideoOff
cast, screen-cast, stream, streaming, connect, wireless, airplay, chromecast, mirroring, display, device, tv-out, multimedia, presentation, wifi, project - Bootstrap Icons - BsCast - SVG | WEBP | PNG | JPG - Icon free download
BsCast
clipboard, check, checked, task, todo, complete, verified, approval, list, document, form, report, notes, ui, dashboard, workflow - Bootstrap Icons - BsClipboardCheckFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardCheckFill
clipboard, data, chart, stats, metrics, analytics, report, dashboard, document, form, summary, filled, ui, workflow - Bootstrap Icons - BsClipboardDataFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardDataFill
clipboard, data, chart, stats, metrics, analytics, report, document, dashboard, form, summary, ui, workflow - Bootstrap Icons - BsClipboardData - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardData
clipboard, filled, document, paper, notes, task, list, form, report, ui, workflow, dashboard, record, paperwork - Bootstrap Icons - BsClipboardFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardFill
clipboard, heart, clipboard-heart, health, medical, care, patient, record, document, task, checklist, favorites, love, wellness, hospital, report, ui, form, page, button, sidebar, nav, android, ios, web, dashboard - Bootstrap Icons - BsClipboardHeart - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardHeart
clipboard, pulse, clipboard-pulse, heartbeat, monitor, health, medical, vitals, record, chart, report, analytics, hospital, wellness, tracking, ui, dashboard - Bootstrap Icons - BsClipboardPulse - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardPulse
clipboard, data, clipboard-data, analytics, chart, stats, report, filled, document, sheet, form, tracking, metrics, business, monitor - Bootstrap Icons - BsClipboard2DataFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2DataFill
clipboard, data, clipboard-data, analytics, stats, report, outline, document, sheet, metrics, dashboard, tracking, business - Bootstrap Icons - BsClipboard2Data - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2Data
clipboard, clipboard2, filled, document, sheet, task, note, form, ui, list, record, writing, entry, office - Bootstrap Icons - BsClipboard2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2Fill
clipboard, clipboard2, plus, add, create, new, document, file, task, note, form, record, entry, insert, report, button, ui, toolbar, menu-action, productivity, office-tool, admin, ios, android, web - Bootstrap Icons - BsClipboard2PlusFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2PlusFill
clipboard, clipboard2, pulse, heartbeat, health, medical, vitals, monitoring, report, record, patient, checkup, filled, hospital, clinic, form, document, health-data, tracking - Bootstrap Icons - BsClipboard2PulseFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2PulseFill
clipboard, clipboard2, pulse, heartbeat, vitals, monitor, health, medical, outline, patient, record, report, data, tracking, hospital, clinic, ui, form - Bootstrap Icons - BsClipboard2Pulse - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2Pulse
clipboard, clipboard2, document, file, note, task, record, form, paper, outline, office, ui, menu-item, toolbar, admin, workflow, checklist - Bootstrap Icons - BsClipboard2 - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2
cookie, biscuit, snack, dessert, food, treat, privacy, cookie-banner, consent, gdpr, settings, preferences, analytics, ui, notification - Bootstrap Icons - BsCookie - SVG | WEBP | PNG | JPG - Icon free download
BsCookie
copy, duplicate, clone, clipboard, document, file, content-copy, ui-action, button, toolbar, menu, repeat, text, editor, productivity - Bootstrap Icons - BsCopy - SVG | WEBP | PNG | JPG - Icon free download
BsCopy
diagram, flowchart, structure, layout, nodes, connections, process, workflow, business, graph, chart, organization, mapping, visual, filled - Bootstrap Icons - BsDiagram2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsDiagram2Fill
display, monitor, screen, desktop, pc, computer, filled, device, hardware, workstation, ui, presentation, preview, layout, dashboard, web, ios, android - Bootstrap Icons - BsDisplayFill - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayFill
display, monitor, screen, desktop, outline, pc, computer, device, hardware, workspace, dashboard, preview, ui, web, minimal, android, ios - Bootstrap Icons - BsDisplay - SVG | WEBP | PNG | JPG - Icon free download
BsDisplay
displayport, port, connector, filled, cable, video-output, monitor, screen, hardware, device, pc, laptop, input-output, tech, ui, web - Bootstrap Icons - BsDisplayportFill - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayportFill
displayport, port, connector, outline, video-output, monitor, hardware, pc, laptop, screen, device, tech, wire, cable, ui, web, ios, android - Bootstrap Icons - BsDisplayport - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayport
door, closed, lock, entry, exit, filled, home, house, room, office, building, security, access, restricted, private, symbol, ui, web, android, ios - Bootstrap Icons - BsDoorClosedFill - SVG | WEBP | PNG | JPG - Icon free download
BsDoorClosedFill
door, closed, outline, entry, exit, home, office, security, private, restricted, room, building, access, state, symbol, ui, web, ios, android - Bootstrap Icons - BsDoorClosed - SVG | WEBP | PNG | JPG - Icon free download
BsDoorClosed
door, open, filled, entry, exit, room, access, unlock, welcome, home, office, building, symbol, state, ui, web, android, ios - Bootstrap Icons - BsDoorOpenFill - SVG | WEBP | PNG | JPG - Icon free download
BsDoorOpenFill
door, open, outline, entry, exit, home, office, building, access, welcome, state, navigation, symbol, ui, web, ios, android - Bootstrap Icons - BsDoorOpen - SVG | WEBP | PNG | JPG - Icon free download
BsDoorOpen
easel, art, painting, canvas, display, presentation, stand, filled, design, creative, drawing, board, artist-tool - Bootstrap Icons - BsEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsEaselFill
easel, canvas, stand, painting, art, outline, creative, design, drawing, presentation, artist-tool, display - Bootstrap Icons - BsEasel - SVG | WEBP | PNG | JPG - Icon free download
BsEasel
easel, easel2, art, canvas, painting, creative, filled, design, drawing, presentation, stand, board, artist - Bootstrap Icons - BsEasel2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsEasel2Fill
easel, easel2, art, canvas, outline, painting, drawing, creative, presentation, design, stand - Bootstrap Icons - BsEasel2 - SVG | WEBP | PNG | JPG - Icon free download
BsEasel2
easel3, easel, art, canvas, painting, drawing, creative, presentation, filled, design, stand, board - Bootstrap Icons - BsEasel3Fill - SVG | WEBP | PNG | JPG - Icon free download
BsEasel3Fill
easel3, easel, art, canvas, outline, painting, drawing, creative, presentation, stand, design - Bootstrap Icons - BsEasel3 - SVG | WEBP | PNG | JPG - Icon free download
BsEasel3
envelope, mail, email, paper, document, letter, message, filled, compose, attachment, office, write - Bootstrap Icons - BsEnvelopePaperFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopePaperFill
file, bar, graph, bar-graph, analytics, report, statistics, chart, data, document, filled, sheet, dashboard, metrics, visual, ui - Bootstrap Icons - BsFileBarGraphFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileBarGraphFill
file, bar, graph, outline, bar-graph, chart, analytics, report, data, sheet, document, dashboard, metrics, stats, ui - Bootstrap Icons - BsFileBarGraph - SVG | WEBP | PNG | JPG - Icon free download
BsFileBarGraph
file, earmark, bar-graph, graph, chart, analytics, report, statistics, dashboard, data, filled, business, finance - Bootstrap Icons - BsFileEarmarkBarGraphFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkBarGraphFill
file, earmark, bar-graph, graph, chart, analytics, report, statistics, dashboard, data, outline, business - Bootstrap Icons - BsFileEarmarkBarGraph - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkBarGraph
file, earmark, easel, presentation, design, art, canvas, creative, education, teaching, filled - Bootstrap Icons - BsFileEarmarkEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkEaselFill
file, earmark, easel, presentation, design, art, canvas, creative, education, outline - Bootstrap Icons - BsFileEarmarkEasel - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkEasel
file, earmark, excel, xlsx, sheet, spreadsheet, table, rows, columns, data, analysis, report, document, office, microsoft, import, export, dashboard, ui, toolbar, button, sidebar - Bootstrap Icons - BsFileEarmarkExcelFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkExcelFill
file, earmark, excel, xlsx, spreadsheet, table, data, document, office, report, analysis, sheet, management, ui, toolbar, list - Bootstrap Icons - BsFileEarmarkExcel - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkExcel
file, earmark, medical, health, doctor, hospital, record, report, rx, clinical, patient, healthcare, ui - Bootstrap Icons - BsFileEarmarkMedicalFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkMedicalFill
file, earmark, medical, health, doctor, report, record, patient, clinic, hospital, healthcare, ui - Bootstrap Icons - BsFileEarmarkMedical - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkMedical
file, earmark, pdf, document, report, form, print, adobe, portable-document, attachment, upload, download, ui - Bootstrap Icons - BsFileEarmarkPdfFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPdfFill
file, earmark, pdf, document, report, form, attachment, adobe, download, upload, ui, print - Bootstrap Icons - BsFileEarmarkPdf - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPdf
file, earmark, plus, add, new, create, document, insert, add-file, new-file, add-document, office, productivity, task, button, symbol, ui-action - Bootstrap Icons - BsFileEarmarkPlusFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPlusFill
file, earmark, plus, add, new, create, insert, add-file, document, outline, office, task, ui, button, action-control - Bootstrap Icons - BsFileEarmarkPlus - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPlus
file, earmark, ppt, presentation, slides, powerpoint, office, business, deck, slide-file, meeting, lecture, training, visual, document - Bootstrap Icons - BsFileEarmarkPptFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPptFill
file, earmark, ppt, presentation, slides, powerpoint, slide-file, meeting, lecture, deck, outline, office, document - Bootstrap Icons - BsFileEarmarkPpt - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPpt
file, earmark, ruled, lined, notebook, notes, write, paper, document, education, journal, record, office, text - Bootstrap Icons - BsFileEarmarkRuledFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkRuledFill
file, earmark, slides, presentation, deck, slide-file, ppt, multimedia, lecture, meeting, class, office, training, visual - Bootstrap Icons - BsFileEarmarkSlidesFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkSlidesFill
file, earmark, slides, presentation, slide-file, deck, ppt, office, lecture, meeting, outline, training - Bootstrap Icons - BsFileEarmarkSlides - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkSlides
file, earmark, spreadsheet, sheet, excel, table, cells, data, analytics, grid, calculation, report, finance, office, document - Bootstrap Icons - BsFileEarmarkSpreadsheetFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkSpreadsheetFill
file, earmark, spreadsheet, excel, sheet, table, data, grid, analytics, calculation, outline, report, finance - Bootstrap Icons - BsFileEarmarkSpreadsheet - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkSpreadsheet
file, earmark, text, document, note, write, paragraph, content, paper, office, record, report, editor - Bootstrap Icons - BsFileEarmarkTextFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkTextFill
file, earmark, text, document, content, write, paper, note, outline, editor, office, record - Bootstrap Icons - BsFileEarmarkText - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkText
file, earmark, word, doc, docx, ms-word, text, document, editor, write, office, content, report, business-file - Bootstrap Icons - BsFileEarmarkWordFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkWordFill
file, earmark, word, word-file, doc, document, text, ms-word, office, writing, editor, content, page, template, download, upload, open, save, share, toolbar, button, nav, sidebar, ui - Bootstrap Icons - BsFileEarmarkWord - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkWord
file, easel, presentation, design, art, canvas, board, creative, draft, layout, mockup, teaching, training, visual, slide, template - Bootstrap Icons - BsFileEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEaselFill
file, easel, presentation, canvas, board, art, design, creative, draft, visual, slide, teaching, training, template, mockup - Bootstrap Icons - BsFileEasel - SVG | WEBP | PNG | JPG - Icon free download
BsFileEasel
file, excel, spreadsheet, xls, xlsx, table, data, sheet, grid, finance, accounting, analysis, numbers, ms-excel, office, report, stats - Bootstrap Icons - BsFileExcelFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileExcelFill
file, excel, spreadsheet, xls, xlsx, table, sheet, data, grid, numbers, finance, accounting, ms-excel, office, report, stats - Bootstrap Icons - BsFileExcel - SVG | WEBP | PNG | JPG - Icon free download
BsFileExcel
file, medical, health, healthcare, record, ehr, emr, hospital, clinic, report, lab, diagnosis, patient, document, page, protected, info - Bootstrap Icons - BsFileMedicalFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileMedicalFill
file, medical, file-medical, health, doctor, clinic, hospital, report, medical-record, healthcare-document, patient-file, pdf, document, form, office-file, attachment, record, archive, folder - Bootstrap Icons - BsFileMedical - SVG | WEBP | PNG | JPG - Icon free download
BsFileMedical
file, pdf, file-pdf, document, attachment, portable-document, report, invoice, form, legal, contract, office, business-file, export, download, archive - Bootstrap Icons - BsFilePdfFill - SVG | WEBP | PNG | JPG - Icon free download
BsFilePdfFill
file, pdf, file-pdf, document, attachment, report, invoice, contract, form, legal, office-file, download, export, archive - Bootstrap Icons - BsFilePdf - SVG | WEBP | PNG | JPG - Icon free download
BsFilePdf
file, post, file-post, message, mail, communication, letter, document, attachment, feed, post-file, announcement, note, office, paper - Bootstrap Icons - BsFilePostFill - SVG | WEBP | PNG | JPG - Icon free download
BsFilePostFill
file, post, file-post, mail, message, communication, document, letter, announcement, note, paper, office, feed - Bootstrap Icons - BsFilePost - SVG | WEBP | PNG | JPG - Icon free download
BsFilePost
file, ppt, file-ppt, presentation, powerpoint, slide, deck, office-file, business, meeting, classroom, education, slides, attachment - Bootstrap Icons - BsFilePptFill - SVG | WEBP | PNG | JPG - Icon free download
BsFilePptFill
file, ppt, file-ppt, presentation, slides, deck, powerpoint, office, meeting, lecture, education, attachment - Bootstrap Icons - BsFilePpt - SVG | WEBP | PNG | JPG - Icon free download
BsFilePpt
file, richtext, file-richtext, text, editor, formatting, document, writing, notes, content, markup, styled-text, article, report, attachment - Bootstrap Icons - BsFileRichtextFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileRichtextFill
file, richtext, file-richtext, text, document, format, writing, notes, editor, styled-text, content, article, report - Bootstrap Icons - BsFileRichtext - SVG | WEBP | PNG | JPG - Icon free download
BsFileRichtext
file, slides, presentation, ppt, slideshow, deck, filled, document, office, education, projector, report, bootstrap, file-slides - Bootstrap Icons - BsFileSlidesFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileSlidesFill
file, slides, presentation, ppt, outline, slideshow, deck, educational, report, meeting, bootstrap, file-slides - Bootstrap Icons - BsFileSlides - SVG | WEBP | PNG | JPG - Icon free download
BsFileSlides
file, spreadsheet, excel, sheet, grid, table, data, analytics, finance, filled, record, database-lite, calculation, report, bootstrap - Bootstrap Icons - BsFileSpreadsheetFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileSpreadsheetFill
file, spreadsheet, excel, sheet, table, data, outline, report, metrics, business-doc, bootstrap, grid - Bootstrap Icons - BsFileSpreadsheet - SVG | WEBP | PNG | JPG - Icon free download
BsFileSpreadsheet
file, text, txt, document, writing, notes, content, filled, draft, editor, report, bootstrap - Bootstrap Icons - BsFileTextFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileTextFill
file, word, doc, docx, microsoft-word, filled, document, editor, office, report, bootstrap - Bootstrap Icons - BsFileWordFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileWordFill
file, csv, spreadsheet, table, data, rows, columns, export, import, analytics, dataset, excel, numbers, records, report, storage, database, flat-file - Bootstrap Icons - BsFiletypeCsv - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeCsv
file, doc, document, word, ms-word, text, writing, report, letter, office, editor, template, paper, content, format, word-file, doc-file - Bootstrap Icons - BsFiletypeDoc - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeDoc
file, docx, document, word, ms-word, text, editor, office, writing, report, letter, doc-file, content, upload, template, format, document-file - Bootstrap Icons - BsFiletypeDocx - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeDocx
file, key, keynote, presentation, slide, apple, mac, deck, talk, ppt, template, design, speaker, office, content, presentation-file - Bootstrap Icons - BsFiletypeKey - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeKey
file, pdf, filetype-pdf, document, report, ebook, invoice, attachment, export, download, reader, acrobat, office, business-file, print, share, archive, menu-item, button, ui-element - Bootstrap Icons - BsFiletypePdf - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypePdf
file, ppt, filetype-ppt, presentation, slides, office, powerpoint, business, meeting, education, report, deck, attachment, download, upload, share, workspace, editor - Bootstrap Icons - BsFiletypePpt - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypePpt
file, pptx, filetype-pptx, presentation, slide-deck, office, powerpoint, business-report, meeting, education, training, download, upload, attachment, share, editor, workspace - Bootstrap Icons - BsFiletypePptx - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypePptx
file, psd, filetype-psd, photoshop, design, template, layer, editor, graphic, creative, asset, art, export, import, project-file, workspace, attachment, download - Bootstrap Icons - BsFiletypePsd - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypePsd
file, sql, filetype-sql, database, query, schema, table, data, backend, dev, analytics, reporting, editor, repo, import, export, model, orm - Bootstrap Icons - BsFiletypeSql - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeSql
file, txt, filetype-txt, text, note, plain-text, editor, document, log, readme, config, data, attachment, download, simple-file, workspace, ui - Bootstrap Icons - BsFiletypeTxt - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeTxt
file, xls, excel, spreadsheet, sheet, table, data, report, analysis, workbook, filetype, office, ms-excel, download, upload, grid, csv, import, export, button, navigation - Bootstrap Icons - BsFiletypeXls - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeXls
file, xlsx, excel, spreadsheet, sheet, table, workbook, analysis, data, report, ms-excel, filetype, import, export, grid, document, download, upload, ui - Bootstrap Icons - BsFiletypeXlsx - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeXlsx
fullscreen-exit, exit, fullscreen, shrink, collapse, screen, view, window, ui-control, media, video, player, layout, toolbar, button, interaction - Bootstrap Icons - BsFullscreenExit - SVG | WEBP | PNG | JPG - Icon free download
BsFullscreenExit
fullscreen, expand, open-fullscreen, screen, window, maximize, ui-control, media, player, layout, button, toolbar - Bootstrap Icons - BsFullscreen - SVG | WEBP | PNG | JPG - Icon free download
BsFullscreen
funnel, filter, filtering, sort, refine, narrow, search-filter, analytics, data, query, options, settings, ui, button, toolbar - Bootstrap Icons - BsFunnelFill - SVG | WEBP | PNG | JPG - Icon free download
BsFunnelFill
funnel, filter, sort, refine, narrow, search-filter, analytics, data, query, options, settings, line-icon, ui, toolbar - Bootstrap Icons - BsFunnel - SVG | WEBP | PNG | JPG - Icon free download
BsFunnel
graph, chart, down-arrow, decline, drop, falling, negative-trend, loss, analytics, statistics, data, dashboard, finance, business - Bootstrap Icons - BsGraphDownArrow - SVG | WEBP | PNG | JPG - Icon free download
BsGraphDownArrow
graph, down, decline, drop, chart, analytics, trend, negative, loss, business, statistics, dashboard, finance - Bootstrap Icons - BsGraphDown - SVG | WEBP | PNG | JPG - Icon free download
BsGraphDown
graph, chart, up-arrow, growth, increase, profit, rise, positive-trend, analytics, statistics, dashboard, finance, business - Bootstrap Icons - BsGraphUpArrow - SVG | WEBP | PNG | JPG - Icon free download
BsGraphUpArrow
graph, up, chart, increase, growth, positive, trend, analytics, statistics, finance, dashboard, business - Bootstrap Icons - BsGraphUp - SVG | WEBP | PNG | JPG - Icon free download
BsGraphUp
hdmi, cable, port, display, connector, video, audio, filled, interface, tv, monitor, projector, hardware - Bootstrap Icons - BsHdmiFill - SVG | WEBP | PNG | JPG - Icon free download
BsHdmiFill
inboxes, multiple-inboxes, mail, email, messages, folders, filled, communication, notification, productivity, sorting, ui - Bootstrap Icons - BsInboxesFill - SVG | WEBP | PNG | JPG - Icon free download
BsInboxesFill
inboxes, inbox, mail, email, messages, folders, storage, archive, communication, workspace, dashboard, ui, sidebar, navigation, container, multiple-inbox, incoming, sorting, organization - Bootstrap Icons - BsInboxes - SVG | WEBP | PNG | JPG - Icon free download
BsInboxes
journal, medical, health, healthcare, report, log, record, doctor, patient, file, document, notes, clinic, hospital - Bootstrap Icons - BsJournalMedical - SVG | WEBP | PNG | JPG - Icon free download
BsJournalMedical
linkedin, brand, logo, social, networking, professional, career, business, resume, profile, job, company, platform - Bootstrap Icons - BsLinkedin - SVG | WEBP | PNG | JPG - Icon free download
BsLinkedin
mailbox, flag, mail, post, letter, delivery, notification, postal, inbox, outbox, home, office, package, message - Bootstrap Icons - BsMailboxFlag - SVG | WEBP | PNG | JPG - Icon free download
BsMailboxFlag
mailbox, mail, post, letter, delivery, postal, inbox, outbox, message, package, home, office, notification - Bootstrap Icons - BsMailbox - SVG | WEBP | PNG | JPG - Icon free download
BsMailbox
mailbox2, mailbox, flag, post, mail, delivery, postal, inbox, outbox, message, package, home, office, notification - Bootstrap Icons - BsMailbox2Flag - SVG | WEBP | PNG | JPG - Icon free download
BsMailbox2Flag
mailbox2, mailbox, mail, post, letter, postal, inbox, outbox, message, package, home, office, delivery - Bootstrap Icons - BsMailbox2 - SVG | WEBP | PNG | JPG - Icon free download
BsMailbox2
marker, tip, pen, highlight, writing, drawing, edit, tool, office, design, sketch, note, annotate, pointer - Bootstrap Icons - BsMarkerTip - SVG | WEBP | PNG | JPG - Icon free download
BsMarkerTip
mic-mute, mute, microphone-off, audio, sound-off, outline, voice, silence, disabled, settings, call, meeting, toolbar - Bootstrap Icons - BsMicMute - SVG | WEBP | PNG | JPG - Icon free download
BsMicMute
microsoft, teams, microsoft-teams, brand, logo, chat, collaboration, communication, video-call, meeting, workplace, office, enterprise, productivity, teamwork, group-chat, messaging, remote-work, desktop, webapp, button, navbar, sidebar - Bootstrap Icons - BsMicrosoftTeams - SVG | WEBP | PNG | JPG - Icon free download
BsMicrosoftTeams
microsoft, brand, logo, windows, office, tech, software, corporate, company, ms, brandmark, enterprise, desktop, ecosystem, productivity, technology-company, webapp, navbar, footer - Bootstrap Icons - BsMicrosoft - SVG | WEBP | PNG | JPG - Icon free download
BsMicrosoft
mouse, computer-mouse, pointer, cursor-device, input-device, hardware, usb, bluetooth, click, scroll, device, peripheral, desktop, laptop, mac, windows, linux, workstation, productivity, office, navigation, ui-control - Bootstrap Icons - BsMouse3 - SVG | WEBP | PNG | JPG - Icon free download
BsMouse3
newspaper, news, article, journal, press, newsletter, headline, report, media, information, update, feed, publication - Bootstrap Icons - BsNewspaper - SVG | WEBP | PNG | JPG - Icon free download
BsNewspaper
paperclip, clip, attachment, attach, file-attach, document, email, message, link, binder, office, outline, ui-action - Bootstrap Icons - BsPaperclip - SVG | WEBP | PNG | JPG - Icon free download
BsPaperclip
pc, display, horizontal, monitor, screen, desktop, computer, hardware, ui, workspace, device - Bootstrap Icons - BsPcDisplayHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsPcDisplayHorizontal
pc, display, monitor, desktop, screen, computer, hardware, device, ui, workspace - Bootstrap Icons - BsPcDisplay - SVG | WEBP | PNG | JPG - Icon free download
BsPcDisplay
pc, horizontal, screen, monitor, computer, desktop, device, hardware, ui - Bootstrap Icons - BsPcHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsPcHorizontal
pc, computer, desktop, workstation, monitor, device, hardware, screen, setup, tech, ui, dashboard, sidebar, toolbar, windows, linux, mac, developer, coding, work - Bootstrap Icons - BsPc - SVG | WEBP | PNG | JPG - Icon free download
BsPc
pen, write, edit, pen-fill, draw, signature, annotation, tool, office, document, form, input, ui, button, action - Bootstrap Icons - BsPenFill - SVG | WEBP | PNG | JPG - Icon free download
BsPenFill
percent, %, percentage, discount, offer, math, symbol, pricing, sale, ecommerce, rate, analytics, finance, stats, ui - Bootstrap Icons - BsPercent - SVG | WEBP | PNG | JPG - Icon free download
BsPercent
person, raised-hand, hand, user, participate, ask, question, volunteer, attention, education, classroom, signal, gesture, bootstrap - Bootstrap Icons - BsPersonRaisedHand - SVG | WEBP | PNG | JPG - Icon free download
BsPersonRaisedHand
person, rolodex, contacts, directory, address-book, user, profile, id-card, records, index, business-contacts, office, bootstrap - Bootstrap Icons - BsPersonRolodex - SVG | WEBP | PNG | JPG - Icon free download
BsPersonRolodex
person, video, camera, call, meeting, conference, user, record, stream, chat, bootstrap, outline - Bootstrap Icons - BsPersonVideo - SVG | WEBP | PNG | JPG - Icon free download
BsPersonVideo
person, video, camera, call, meeting, conference, user, chat, stream, record, bootstrap, variant - Bootstrap Icons - BsPersonVideo2 - SVG | WEBP | PNG | JPG - Icon free download
BsPersonVideo2
person, video, camera, meeting, conference, chat, record, stream, user, bootstrap, outline, third-style - Bootstrap Icons - BsPersonVideo3 - SVG | WEBP | PNG | JPG - Icon free download
BsPersonVideo3
person, workspace, user, work, office, desk, employee, staff, team, avatar, profile, business, corporate, tasks, job, workplace, dashboard, ui, menu, sidebar - Bootstrap Icons - BsPersonWorkspace - SVG | WEBP | PNG | JPG - Icon free download
BsPersonWorkspace
phone, flip, rotate, orientation, mobile, device, smartphone, call, contact, communication, rotate-phone, screen, ui, gesture, interaction - Bootstrap Icons - BsPhoneFlip - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneFlip
phone, landscape, horizontal, rotate, mobile, device, smartphone, responsive, call, screen, ui, layout, orientation - Bootstrap Icons - BsPhoneLandscape - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneLandscape
pie, chart, pie-chart, statistics, analytics, data, report, graph, visualization, dashboard, metrics, segments, ui, widget, finance, business - Bootstrap Icons - BsPieChartFill - SVG | WEBP | PNG | JPG - Icon free download
BsPieChartFill
pie, chart, pie-chart, data, analytics, visual, graph, report, statistics, dashboard, metrics, segments, ui, widget, presentation - Bootstrap Icons - BsPieChart - SVG | WEBP | PNG | JPG - Icon free download
BsPieChart
printer, print, device, hardware, filled, office, copy, document - Bootstrap Icons - BsPrinterFill - SVG | WEBP | PNG | JPG - Icon free download
BsPrinterFill
printer, print, hardware, office, outline, copy, document - Bootstrap Icons - BsPrinter - SVG | WEBP | PNG | JPG - Icon free download
BsPrinter
projector, presentation, display, filled, media, screen, office - Bootstrap Icons - BsProjectorFill - SVG | WEBP | PNG | JPG - Icon free download
BsProjectorFill
projector, presentation, display, outline, meeting, screen, media - Bootstrap Icons - BsProjector - SVG | WEBP | PNG | JPG - Icon free download
BsProjector
receipt, bill, invoice, transaction, payment, checkout, shop, store, document, bill-paper, finance, office, outline - Bootstrap Icons - BsReceipt - SVG | WEBP | PNG | JPG - Icon free download
BsReceipt
rocket, launch, startup, growth, boost, acceleration, filled, space, ship, takeoff, innovate, progress, speed, branding, business, development, icon, ui - Bootstrap Icons - BsRocketFill - SVG | WEBP | PNG | JPG - Icon free download
BsRocketFill
rocket, takeoff, launch, startup, space, ship, boost, acceleration, growth, filled, lift-off, innovation, progress, business, ui, ux - Bootstrap Icons - BsRocketTakeoffFill - SVG | WEBP | PNG | JPG - Icon free download
BsRocketTakeoffFill
ruler, rulers, measure, measurement, length, design, layout, spacing, drafting, tool, ui-design, grid, craft, alignment, editor, workspace - Bootstrap Icons - BsRulers - SVG | WEBP | PNG | JPG - Icon free download
BsRulers
skype, brand, microsoft, chat, messaging, video-call, voice-call, communication, meeting, conference, collaboration, team, contact, online, social, platform, logo, brand-icon, communication-tool, softphone - Bootstrap Icons - BsSkype - SVG | WEBP | PNG | JPG - Icon free download
BsSkype
slack, brand, logo, team, workspace, communication, collaboration, chat, messaging, channels, work, office, productivity, online, platform, brand-icon, remote-work, team-chat, business-tool - Bootstrap Icons - BsSlack - SVG | WEBP | PNG | JPG - Icon free download
BsSlack
sort, numeric, number, up, ascending, alt, order, arrange, list, table, data-sort, filter, ui, ux, dashboard, stats, analytics, header, toolbar, button, active, hover - Bootstrap Icons - BsSortNumericUpAlt - SVG | WEBP | PNG | JPG - Icon free download
BsSortNumericUpAlt
sort, numeric, number, up, ascending, order, arrange, list, table, dashboard, stats, analytics, data-sort, ui, ux, filter, button, toolbar - Bootstrap Icons - BsSortNumericUp - SVG | WEBP | PNG | JPG - Icon free download
BsSortNumericUp
sort, up, ascending, alt, order, arrange, alphabetical, text-sort, ui, ux, filter, table, list, dashboard, analytics - Bootstrap Icons - BsSortUpAlt - SVG | WEBP | PNG | JPG - Icon free download
BsSortUpAlt
speedometer, gauge, meter, speed, performance, dashboard, indicator, monitor, stats, analytics, needle, ui, measurement - Bootstrap Icons - BsSpeedometer - SVG | WEBP | PNG | JPG - Icon free download
BsSpeedometer
speedometer, gauge, meter, speed, performance, monitor, dash, indicator, needle, stats, ui, analytics, measurement, variant - Bootstrap Icons - BsSpeedometer2 - SVG | WEBP | PNG | JPG - Icon free download
BsSpeedometer2
stickies, sticky-notes, notes, memo, reminder, tasks, todo, office, organize, paper-note, filled, post-it, note-card, label, tag, planning, ui, dashboard, widget - Bootstrap Icons - BsStickiesFill - SVG | WEBP | PNG | JPG - Icon free download
BsStickiesFill
stickies, sticky-notes, notes, memo, reminder, task, todo, office, organizer, post-it, note-card, label, tag, planner, ui, dashboard, paper - Bootstrap Icons - BsStickies - SVG | WEBP | PNG | JPG - Icon free download
BsStickies
tablet, device, mobile, screen, touch, app, ui, hardware, electronics, filled-device - Bootstrap Icons - BsTabletFill - SVG | WEBP | PNG | JPG - Icon free download
BsTabletFill
tablet, landscape, device, orientation, mobile, screen, touch, ui, hardware, filled-device - Bootstrap Icons - BsTabletLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsTabletLandscapeFill
tablet, landscape, orientation, device, mobile, ui, screen, outline-device - Bootstrap Icons - BsTabletLandscape - SVG | WEBP | PNG | JPG - Icon free download
BsTabletLandscape
tablet, device, screen, mobile, touch, electronics, ui, outline - Bootstrap Icons - BsTablet - SVG | WEBP | PNG | JPG - Icon free download
BsTablet
terminal, split, pane, window, cli, shell, console, multi-pane, developer, coding, split-view, layout, outline, productivity - Bootstrap Icons - BsTerminalSplit - SVG | WEBP | PNG | JPG - Icon free download
BsTerminalSplit
tv, television, screen, display, monitor, media, video, movie, streaming, entertainment, device, electronics, filled, dashboard-widget - Bootstrap Icons - BsTvFill - SVG | WEBP | PNG | JPG - Icon free download
BsTvFill
tv, television, screen, display, monitor, media, video, movie, streaming, entertainment, device, electronics, outline - Bootstrap Icons - BsTv - SVG | WEBP | PNG | JPG - Icon free download
BsTv
webcam, camera, video, record, stream, meeting, call, device, conference, ui - Bootstrap Icons - BsWebcamFill - SVG | WEBP | PNG | JPG - Icon free download
BsWebcamFill
webcam, camera, video, device, stream, record, meeting, conference, ui - Bootstrap Icons - BsWebcam - SVG | WEBP | PNG | JPG - Icon free download
BsWebcam
desktop, window, computer, monitor, ui-window, screen, os, system, app-window, layout - Bootstrap Icons - BsWindowDesktop - SVG | WEBP | PNG | JPG - Icon free download
BsWindowDesktop
fullscreen, expand, window, maximize, screen, ui-window, layout, display, view-mode, system - Bootstrap Icons - BsWindowFullscreen - SVG | WEBP | PNG | JPG - Icon free download
BsWindowFullscreen
window, ui-window, panel, screen, layout, desktop, app-window, system, container, software - Bootstrap Icons - BsWindow - SVG | WEBP | PNG | JPG - Icon free download
BsWindow
yelp, brand, review, rating, restaurant, business, directory, local, social, platform - Bootstrap Icons - BsYelp - SVG | WEBP | PNG | JPG - Icon free download
BsYelp
board, whiteboard, task-board, kanban, planning, organize, layout, workspace, project, dashboard, notes, sticky-notes, scrum, agile, todo, ui-element, widget - css.gg Icons - CgBoard - SVG | WEBP | PNG | JPG - Icon free download
CgBoard
briefcase, work, job, office, business, career, portfolio, documents, client, professional, bag, case, employee - css.gg Icons - CgBriefcase - SVG | WEBP | PNG | JPG - Icon free download
CgBriefcase
chart, graph, analytics, data, stats, statistics, trend, performance, dashboard, line-chart, bar-chart, visualization, report, metric, kpi, widget, ui, interface, business, finance, insights - css.gg Icons - CgChart - SVG | WEBP | PNG | JPG - Icon free download
CgChart
cg, clipboard, copy, paste, notes, document, checklist, task, todo, form, report, admin, profile, clipboard-copy, clipboard-paste, button, icon-button, line, ui - css.gg Icons - CgClipboard - SVG | WEBP | PNG | JPG - Icon free download
CgClipboard
data, analytics, info, metrics, statistics, storage, dataset, processing, network, backend, integration, tech, ui, ux, cloud, server - css.gg Icons - CgData - SVG | WEBP | PNG | JPG - Icon free download
CgData
desktop, computer, monitor, screen, pc, display, workstation, device, setup, ui, window, dashboard, workspace, hardware, electronics, home screen, office desk, system ui, toolbar icon, menu icon, panel, layout, productivity, coding setup, developer tools, tech - css.gg Icons - CgDesktop - SVG | WEBP | PNG | JPG - Icon free download
CgDesktop
dock, window, dock window, ui window, panel, sidebar, layout, workspace, desktop, toolbar, modal, frame, ui element, navigation, window manager, app window, window layout, split view, multiwindow, productivity, designer tools, editor, dashboard, interface block, container - css.gg Icons - CgDockWindow - SVG | WEBP | PNG | JPG - Icon free download
CgDockWindow
duplicate, copy, clone, duplicate file, duplicate item, documents, files, clipboard, copy action, editor, ui control, copy paste, content duplication, replicate, duplicate block, productivity, workflow, form tools, page copy, multiple items - css.gg Icons - CgDuplicate - SVG | WEBP | PNG | JPG - Icon free download
CgDuplicate
ereader, ebook, reader, digital book, tablet, kindle, reading, study, learning, content, article, news, document, device, mobile, screen, text, library, education, publication - css.gg Icons - CgEreader - SVG | WEBP | PNG | JPG - Icon free download
CgEreader
expand, resize, fullscreen, maximize, enlarge, zoom out, layout, window, ui control, open, spread, screen, navigation, button, toolbar, interaction, panel, modal, popout, desktop, mobile, fluid layout - css.gg Icons - CgExpand - SVG | WEBP | PNG | JPG - Icon free download
CgExpand
figma, figma logo, design, ui, ux, wireframe, prototype, branding, collaboration, editor, tool, software, vector, interface, workspace, design system, teamwork - css.gg Icons - CgFigma - SVG | WEBP | PNG | JPG - Icon free download
CgFigma
file add, add file, new file, create file, document, add, plus, upload, insert, create, office, form, draft, note, attachment, toolbar, action button - css.gg Icons - CgFileAdd - SVG | WEBP | PNG | JPG - Icon free download
CgFileAdd
file document, document, file, paper, note, report, page, sheet, office, text file, record, archive, attachment, ui, toolbar, viewer, ios, android - css.gg Icons - CgFileDocument - SVG | WEBP | PNG | JPG - Icon free download
CgFileDocument
file, document, paper, page, sheet, note, record, archive, attachment, text file, office, ui, browser, viewer, placeholder, generic file - css.gg Icons - CgFile - SVG | WEBP | PNG | JPG - Icon free download
CgFile
folder add, folder, add folder, new folder, create folder, directory, file system, storage, workspace, documents, organization, plus, add, insert, new, ui, toolbar, menu, button, sidebar, file manager, explorer, ios, android, web app, content management, structure, project - css.gg Icons - CgFolderAdd - SVG | WEBP | PNG | JPG - Icon free download
CgFolderAdd
folder, directory, file, file manager, storage, documents, workspace, organization, project folder, explorer, ui, toolbar, button, menu, sidebar, content management, cms, file system, ios, android, web app, structure - css.gg Icons - CgFolder - SVG | WEBP | PNG | JPG - Icon free download
CgFolder
justify, text justify, full alignment, alignment, paragraph, editor, rich text, formatting, document layout, text block, ui control, toolbar, content alignment, word processor, writing tools, presentation, column layout, markdown - css.gg Icons - CgFormatJustify - SVG | WEBP | PNG | JPG - Icon free download
CgFormatJustify
right align, align right, text right, alignment, paragraph, editor, rich text, formatting, document layout, writing tools, ui control, toolbar button, page builder, content alignment, presentation - css.gg Icons - CgFormatRight - SVG | WEBP | PNG | JPG - Icon free download
CgFormatRight
google, tasks, google tasks, brand, checklist, todo, task list, productivity, planner, schedule, organization, task manager, workflow, reminders, planning, office, work, project management, task app, list icon, mobile ui, web app - css.gg Icons - CgGoogleTasks - SVG | WEBP | PNG | JPG - Icon free download
CgGoogleTasks
google, brand, logo, search, engine, internet, browser, gmail, maps, drive, workspace, web, chrome, android, seo, indexing, homepage, header icon, footer icon, sidebar icon - css.gg Icons - CgGoogle - SVG | WEBP | PNG | JPG - Icon free download
CgGoogle
home screen, mobile, screen, layout, homepage, dashboard, ui, navigation, start, welcome, root page, panel, app home, tablet, smartphone - css.gg Icons - CgHomeScreen - SVG | WEBP | PNG | JPG - Icon free download
CgHomeScreen
inbox, mailbox, messages, email, incoming, notification, queue, tasks, workspace, storage, inbox tray, communication, receive, documents, files, mail center, message center, folder inbox, new items, task list - css.gg Icons - CgInbox - SVG | WEBP | PNG | JPG - Icon free download
CgInbox
insights, analytics, metrics, stats, chart, data, report, business intelligence, overview, dashboard, tracking, performance, visualization, trends, monitoring, kpi, analysis, data tools - css.gg Icons - CgInsights - SVG | WEBP | PNG | JPG - Icon free download
CgInsights
laptop, computer, notebook, pc, device, workstation, tech, desktop replacement, coding, developer, designer, ui, dashboard, workspace, remote work, portable device, electronics, hardware, screen, monitor, browser, web app, toolbar, menu - css.gg Icons - CgLaptop - SVG | WEBP | PNG | JPG - Icon free download
CgLaptop
divide, division, math divide, operator, slash dot, math symbol, fraction, calculation, compute, formula, analytics, equation, scientific, calculator, editor math, material math, ios calculator, android calculator, stem, education, numerical - css.gg Icons - CgMathDivide - SVG | WEBP | PNG | JPG - Icon free download
CgMathDivide
equal, equals, math equal, operator, math symbol, comparison, calculation, compute, formula, numeric, analytics, calculator, evaluation, logic, boolean, material math, ios calculator, android calculator, editor math, STEM, equation - css.gg Icons - CgMathEqual - SVG | WEBP | PNG | JPG - Icon free download
CgMathEqual
minus, subtract, math minus, operator, math symbol, deduct, remove, calculation, compute, formula, negative, analytics, calculator, equation, material math, ios calculator, android calculator, STEM, numeric operator - css.gg Icons - CgMathMinus - SVG | WEBP | PNG | JPG - Icon free download
CgMathMinus
percent, percentage, math percent, discount, rate, ratio, finance, interest, sale, offer, calculation, analytics, metric, formula, commerce, pricing, material percent, ios calculator, android calculator, statistic, value - css.gg Icons - CgMathPercent - SVG | WEBP | PNG | JPG - Icon free download
CgMathPercent
maximize, expand, full screen, resize, window enlarge, zoom out frame, ui control, panel expand, layout action, screen toggle, workspace, window tool, toggle size, ios, android, desktop app - css.gg Icons - CgMaximize - SVG | WEBP | PNG | JPG - Icon free download
CgMaximize
microsoft, brand, windows, office, teams, azure, tech company, software, enterprise, productivity, cloud services, ms, logo, suite, apps, saas, operating system, developer tools, business tools - css.gg Icons - CgMicrosoft - SVG | WEBP | PNG | JPG - Icon free download
CgMicrosoft
monday, day, weekday, calendar, date, schedule, planner, workweek, task, agenda, timeline, events, reminder, organize, office, productivity, ui calendar, workday, week start - css.gg Icons - CgMonday - SVG | WEBP | PNG | JPG - Icon free download
CgMonday
organisation, organization, hierarchy, structure, team, company, business, groups, workflow, chart, org chart, department, corporate, roles, users, collaboration, management, network, enterprise, diagram - css.gg Icons - CgOrganisation - SVG | WEBP | PNG | JPG - Icon free download
CgOrganisation
performance, speed, metrics, analytics, gauge, dashboard, system performance, optimization, boost, kpi, stats, chart, indicator, monitoring, load, benchmark, efficiency, measurement, tracking, ui dashboard, status monitor - css.gg Icons - CgPerformance - SVG | WEBP | PNG | JPG - Icon free download
CgPerformance
poll, survey, vote, results, chart, bar chart, analytics, statistics, data, metrics, graph, feedback, questionnaire, research, insights, trends, dashboard, reporting - css.gg Icons - CgPoll - SVG | WEBP | PNG | JPG - Icon free download
CgPoll
presentation, slides, projector, screen, whiteboard, meeting, pitch, business, office, classroom, teach, demo, analytics, charts, report, briefing, workspace, productivity - css.gg Icons - CgPresentation - SVG | WEBP | PNG | JPG - Icon free download
CgPresentation
printer, print, device, hardware, office, document, paper, copy, scan, output, file, stationery, settings, utility, peripheral, workstation - css.gg Icons - CgPrinter - SVG | WEBP | PNG | JPG - Icon free download
CgPrinter
ratio, proportion, scale, measurement, comparison, analytics, math, statistics, data, metric, aspect ratio, graphing, calculation, ui metric, dashboard, reporting, design tool, editor tool, layout planning, numeric indicator - css.gg Icons - CgRatio - SVG | WEBP | PNG | JPG - Icon free download
CgRatio
screen mirror, cast, mirroring, screen share, display cast, wireless display, airplay, project screen, presentation, remote display, stream screen, monitor share, connect device - css.gg Icons - CgScreenMirror - SVG | WEBP | PNG | JPG - Icon free download
CgScreenMirror
wide screen, screen wide, monitor, display, widescreen, ultrawide, desktop, resolution, aspect ratio, landscape, tv, presentation, workspace, layout, frame, panel, ui frame, window, hardware, device - css.gg Icons - CgScreenWide - SVG | WEBP | PNG | JPG - Icon free download
CgScreenWide
screen, monitor, display, desktop, device, frame, window, layout, resolution, panel, tv, presentation, workstation, ui, hardware, system panel, viewport, app window - css.gg Icons - CgScreen - SVG | WEBP | PNG | JPG - Icon free download
CgScreen
shortcut, quick action, hotkey, key command, fast access, jump, navigate, link, arrow shortcut, productivity, workflow, speed, fast navigation, ios, android, macos, windows, ux, ui tool, toolbar action - css.gg Icons - CgShortcut - SVG | WEBP | PNG | JPG - Icon free download
CgShortcut
sidebar open, sidebar, open panel, navigation drawer, left menu, ui panel, layout, expand, drawer, menu open, workspace, column, panel view, ios, android, responsive ui, web app, dashboard, split view - css.gg Icons - CgSidebarOpen - SVG | WEBP | PNG | JPG - Icon free download
CgSidebarOpen
sidebar right, right panel, navigation drawer, panel, drawer, column right, layout control, workspace, toggle panel, ui component, responsive layout, menu, expand panel, ios, android, web, fluent ui style - css.gg Icons - CgSidebarRight - SVG | WEBP | PNG | JPG - Icon free download
CgSidebarRight
sidebar, panel, drawer, menu, navigation bar, layout, column, ui container, panel view, toggle menu, workspace, dashboard, responsive ui, ios, android, web, material style - css.gg Icons - CgSidebar - SVG | WEBP | PNG | JPG - Icon free download
CgSidebar
slack, brand, chat, messaging, team, workspace, collaboration, communication, work chat, channels, dm, company communication, remote work, notifications, productivity app, teamwork, group chat, workflows - css.gg Icons - CgSlack - SVG | WEBP | PNG | JPG - Icon free download
CgSlack
stopwatch, timer, time, countdown, chronometer, track time, measure time, clock, interval, productivity, fitness timer, schedule, performance, laps, ui time, css gg - css.gg Icons - CgStopwatch - SVG | WEBP | PNG | JPG - Icon free download
CgStopwatch
studio, creative, editing, workspace, media production, design studio, content creation, creative suite, film, audio, video, art tools, digital studio, creator, css gg - css.gg Icons - CgStudio - SVG | WEBP | PNG | JPG - Icon free download
CgStudio
tally, count, marks, score, measurement, tracking, stats, record, data, counting lines, notes, list, log, analytics, math, ui counter, evaluation - css.gg Icons - CgTally - SVG | WEBP | PNG | JPG - Icon free download
CgTally
time, clock, hour, timer, schedule, duration, countdown, moment, alarm, reminder, timeline, clock face, time tracking, productivity, work timer, hours, time indicator - css.gg Icons - CgTime - SVG | WEBP | PNG | JPG - Icon free download
CgTime
timer, time, countdown, clock, stopwatch, alarm, duration, schedule, task timer, productivity, interval, time tracking, timeout, reminder, control, ui element, widget, minimal, outline icon, interface component - css.gg Icons - CgTimer - SVG | WEBP | PNG | JPG - Icon free download
CgTimer
transcript, document, text file, notes, report, summary, speech-to-text, caption, record, academic transcript, paper, file, paragraph, media captions, meeting notes, log, documentation, official record, print, text content, writing, editor, reading - css.gg Icons - CgTranscript - SVG | WEBP | PNG | JPG - Icon free download
CgTranscript
trello, brand, kanban, boards, tasks, project management, collaboration, productivity, planning, workflow, task board, scrum, agile, jira alternative, team work, organize, lists, cards, project tracking, team tools, planning board - css.gg Icons - CgTrello - SVG | WEBP | PNG | JPG - Icon free download
CgTrello
trending down, decline, drop, downtrend, loss, decrease, chart down, stock fall, bearish, negative trend, analytics, performance drop, economy, finance, stats, business metrics, market, profit loss, graph down, indicator, trendline, data visualization - css.gg Icons - CgTrendingDown - SVG | WEBP | PNG | JPG - Icon free download
CgTrendingDown
trending, trend, upward, growth, analytics, performance, chart, stats, popularity, hot, rise, arrow, dashboard, metric, insights, kpi, ranking, report, data, graph, indicator, boost, engagement - css.gg Icons - CgTrending - SVG | WEBP | PNG | JPG - Icon free download
CgTrending
tv, television, screen, display, monitor, video, stream, broadcast, media, entertainment, show, movie, series, watch, smart tv, home theater, device, program, display unit, electronics, output device - css.gg Icons - CgTv - SVG | WEBP | PNG | JPG - Icon free download
CgTv
userlane, flow, journey, user path, workflow, process, steps, guided tour, onboarding, analytics, interaction flow, ux path, sequence, customer journey - css.gg Icons - CgUserlane - SVG | WEBP | PNG | JPG - Icon free download
CgUserlane
view split, split view, dual pane, side by side, panel split, code editor, file compare, layout toggle, preview split, window split, ui layout, workflow, productivity, organize panels - css.gg Icons - CgViewSplit - SVG | WEBP | PNG | JPG - Icon free download
CgViewSplit
webcam, camera, video camera, stream, record, livestream, broadcast, video call, meeting, teleconference, zoom, teams, capture, vlog, security camera, monitoring, lens, peripheral - css.gg Icons - CgWebcam - SVG | WEBP | PNG | JPG - Icon free download
CgWebcam
work, job, briefcase, office, career, employment, tasks, business, workplace, professional, portfolio, employee, management, job listing, task management, corporate, admin - css.gg Icons - CgWorkAlt - SVG | WEBP | PNG | JPG - Icon free download
CgWorkAlt
alarm, off, alarm off, clock, disable alarm, mute alert, silent, no notifications, timer, time control, schedule, stop alarm, reminder, productivity, ui control, toolbar icon, status indicator, muted state, inactive alert, ios, android, web ui - Circum Icons - CiAlarmOff - SVG | WEBP | PNG | JPG - Icon free download
CiAlarmOff
alarm, on, alarm on, clock, active alert, timer, schedule, reminder, wake up, notification, time management, productivity, status active, ui control, toolbar, header action, bell, timed alert, alarm enabled, ios, android, web ui - Circum Icons - CiAlarmOn - SVG | WEBP | PNG | JPG - Icon free download
CiAlarmOn
brightness down, brightness, dim, lower brightness, display, screen, monitor, device control, settings, adjust, sun icon, light, dark mode, ui control, toolbar, quick settings, accessibility - Circum Icons - CiBrightnessDown - SVG | WEBP | PNG | JPG - Icon free download
CiBrightnessDown
brightness up, brightness, increase brightness, display, screen, monitor, light, sun, adjust, settings, ui control, toolbar, accessibility, system toggle, quick actions - Circum Icons - CiBrightnessUp - SVG | WEBP | PNG | JPG - Icon free download
CiBrightnessUp
calendar date, calendar, date, event, schedule, time, appointment, deadline, planner, task, meeting, booking, reminder, organize, timeline, day view, monthly view, ui calendar, datepicker, form input, agenda - Circum Icons - CiCalendarDate - SVG | WEBP | PNG | JPG - Icon free download
CiCalendarDate
clock, time, clock1, hour, minute, watch, schedule, timer, alarm, deadline, meeting, event, reminder, countdown, dashboard, time picker, ios, android, web - Circum Icons - CiClock1 - SVG | WEBP | PNG | JPG - Icon free download
CiClock1
clock, time, clock2, hour, minute, watch, schedule, timer, alarm, deadline, meeting, event, reminder, countdown, time picker, dashboard, ios, android, web - Circum Icons - CiClock2 - SVG | WEBP | PNG | JPG - Icon free download
CiClock2
coffee, cup, coffee cup, hot drink, latte, tea, mug, cafe, barista, break time, refreshment, morning, work break, drink, menu, beverage, office, branding, takeaway, steam - Circum Icons - CiCoffeeCup - SVG | WEBP | PNG | JPG - Icon free download
CiCoffeeCup
database, db, storage, server, data, dataset, warehouse, cloud db, backend, infrastructure, stack, query, sql, nosql, table, data center, admin, monitoring, analytics, system, devops, dashboard, schema, connection - Circum Icons - CiDatabase - SVG | WEBP | PNG | JPG - Icon free download
CiDatabase
mouse, desktop mouse, computer mouse, peripheral, pointer, cursor, input device, click, hardware, pc, workstation, office, controller, navigation, ui interaction, ios, android, desktop ui, ergonomics, gadget - Circum Icons - CiDesktopMouse1 - SVG | WEBP | PNG | JPG - Icon free download
CiDesktopMouse1
desktop, computer, monitor, screen, display, pc, workstation, device, hardware, ui, window, os, browser, coding, design, dashboard, frontend, backend, work, office, productivity, tech - Circum Icons - CiDesktop - SVG | WEBP | PNG | JPG - Icon free download
CiDesktop
folder on, active folder, open folder, document folder, file storage, directory, outline folder, line folder, file manager, navigation folder, library folder, workspace, content folder, ui folder, project folder - Circum Icons - CiFolderOn - SVG | WEBP | PNG | JPG - Icon free download
CiFolderOn
keyboard, typing, keys, input device, hardware, computer, laptop, pc, mechanical keyboard, gaming keyboard, hotkeys, shortcut, command, editor, text input, programming, workflow, office, peripheral, device control - Circum Icons - CiKeyboard - SVG | WEBP | PNG | JPG - Icon free download
CiKeyboard
laptop, notebook, computer, pc, device, workstation, programming, coding, remote work, study, office, portable computer, screen, display, tech, hardware, electronics, workflow, online meeting, digital work - Circum Icons - CiLaptop - SVG | WEBP | PNG | JPG - Icon free download
CiLaptop
linkedin, brand, social media, professional network, career, resume, profile, business, company page, connect, job search, logo, social button, network, messaging, corporate, hr, recruiting, team, branding - Circum Icons - CiLinkedin - SVG | WEBP | PNG | JPG - Icon free download
CiLinkedin
maximize, expand, full screen, resize, window, ui control, screen, layout, enlarge, open, view, fullscreen toggle, toolbar, button, header, desktop ui, mobile ui, ios, android - Circum Icons - CiMaximize1 - SVG | WEBP | PNG | JPG - Icon free download
CiMaximize1
medical clipboard, clipboard, health record, patient chart, medical form, report, document, checklist, notes, assessment, hospital record, clinic documentation, nursing chart, paperwork, health data - Circum Icons - CiMedicalClipboard - SVG | WEBP | PNG | JPG - Icon free download
CiMedicalClipboard
medical clipboard, clipboard, health record, patient chart, medical form, report, document, checklist, notes, assessment, hospital record, clinic documentation, nursing chart, paperwork, health data - Circum Icons - CiMedicalClipboard - SVG | WEBP | PNG | JPG - Icon free download
CiMedicalClipboard
monitor, screen, display, desktop, computer, pc, workstation, tech, device, ui layout, web design, coding, editor, dashboard, analytics screen, presentation, workspace, hardware, resolution, flat screen, lcd, interface, window, browser, view - Circum Icons - CiMonitor - SVG | WEBP | PNG | JPG - Icon free download
CiMonitor
monitor, screen, display, desktop, computer, pc, workstation, tech, device, ui layout, web design, coding, editor, dashboard, analytics screen, presentation, workspace, hardware, resolution, flat screen, lcd, interface, window, browser, view - Circum Icons - CiMonitor - SVG | WEBP | PNG | JPG - Icon free download
CiMonitor
stopwatch, timer, clock, countdown, chronograph, time tracking, measure time, task timer, productivity, workout timer, sports timing, deadline, schedule, ios, android, outline clock, toolbar icon, ui timer - Circum Icons - CiStopwatch - SVG | WEBP | PNG | JPG - Icon free download
CiStopwatch
temp high, high temperature, heat, hot, temperature alert, climate, weather, thermometer, environment, heatwave, warning, safety indicator, sensor data, analytics, outline temperature, ui status - Circum Icons - CiTempHigh - SVG | WEBP | PNG | JPG - Icon free download
CiTempHigh
timer, clock, time, countdown, stopwatch, alarm, duration, schedule, deadline, productivity, task, reminder, ui, system, status, time tracking, measurement, hour, minute, second, time control, chronometer, interval - Circum Icons - CiTimer - SVG | WEBP | PNG | JPG - Icon free download
CiTimer
video off, camera off, disable video, mute video, call, meeting, conference, webcam, streaming, communication, media, status, indicator, toggle, privacy, recording off, toolbar action, ui control - Circum Icons - CiVideoOff - SVG | WEBP | PNG | JPG - Icon free download
CiVideoOff
video on, camera on, enable video, webcam, streaming, live, recording, conference, call, communication, media, toggle, status, video feed, ui control, toolbar, meeting, capture - Circum Icons - CiVideoOn - SVG | WEBP | PNG | JPG - Icon free download
CiVideoOn
view board, whiteboard, board, display, presentation, dashboard, analytics, screen, workspace, teaching, education, planning, ui panel, layout, diagram, workflow, organize, visual board - Circum Icons - CiViewBoard - SVG | WEBP | PNG | JPG - Icon free download
CiViewBoard
view table, table layout, grid, spreadsheet, rows, columns, data table, database view, sheet, excel style, analytics, dashboard table, ui layout, structured data, tabular data, editor, data grid, pivot, report - Circum Icons - CiViewTable - SVG | WEBP | PNG | JPG - Icon free download
CiViewTable
wave, pulse, waveform, signal, audio, heartbeat, monitor, sensor, oscillation, visualizer, equalizer, spectrum, real-time, live data, streaming, analytics, dashboard, health tracker, iot sensor, media player, sound, voice, widget, control, animation, status, indicator, inspect, measure, visual - Circum Icons - CiWavePulse1 - SVG | WEBP | PNG | JPG - Icon free download
CiWavePulse1
aptana, ide, editor, web development, html, css, javascript, coding tool, developer environment, runtime, plugin, opensource ide, productivity tool, workspace, project editor, web apps - Devicons - DiAptana - SVG | WEBP | PNG | JPG - Icon free download
DiAptana
atom, editor, text editor, coding, opensource, github editor, syntax, workspace, packages, themes, developer tool, lightweight editor, script editor, project manager, source code, ide alternative - Devicons - DiAtom - SVG | WEBP | PNG | JPG - Icon free download
DiAtom
cloud9, aws cloud9, cloud ide, online editor, ide, coding, developer, workspace, collaboration, cloud tools, remote development, browser ide, env, deployment, coding environment, web ide, programming - Devicons - DiCloud9 - SVG | WEBP | PNG | JPG - Icon free download
DiCloud9
coda, panic coda, text editor, ide, developer tool, mac editor, programming, coding, web development, workspace, syntax, project editor, software tools, tech, developer environment, frontend, backend - Devicons - DiCoda - SVG | WEBP | PNG | JPG - Icon free download
DiCoda
codepen, pen, sandbox, frontend, html css js, live editor, snippets, developer, demo, preview, ui design, web tools, creative coding, prototyping, community, embed, coding playground - Devicons - DiCodepen - SVG | WEBP | PNG | JPG - Icon free download
DiCodepen
css3, css, styling, frontend, stylesheet, design, layout, web dev, animation, responsive design, ui, html css, browser styling, frameworks, web components, grid, flexbox, theme, appearance, presentation - Devicons - DiCss3Full - SVG | WEBP | PNG | JPG - Icon free download
DiCss3Full
css3, css, frontend, stylesheet, design, layout, web dev, ui, theme, browser styling, grid, flexbox, animation, responsive, presentation, style sheet, web components, developer tools, html css - Devicons - DiCss3 - SVG | WEBP | PNG | JPG - Icon free download
DiCss3
cssdeck, sandbox, frontend, css editor, live editor, playground, testing, experiments, ui design, web dev, html css, prototyping, code share, snippet, interactive coding, developer tools, demo, layout testing, design experiments, browser tools - Devicons - DiCssdeck - SVG | WEBP | PNG | JPG - Icon free download
DiCssdeck
dropbox, cloud storage, file sync, file sharing, backup, collaboration, team folders, documents, cloud, storage service, drive, upload, download, workspace, productivity, remote work, sharing platform, security, brand - Devicons - DiDropbox - SVG | WEBP | PNG | JPG - Icon free download
DiDropbox
eclipse, eclipse ide, java ide, developer tools, code editor, ide, programming, workspace, open source, dev environment, plugins, debug, refactor, compiler, productivity tool, software, java development, coding tool - Devicons - DiEclipse - SVG | WEBP | PNG | JPG - Icon free download
DiEclipse
firebase, firebase logo, google firebase, backend as a service, baas, realtime database, firestore, authentication, hosting, cloud, mobile apps, web apps, push notifications, analytics, crashlytics, functions, serverless, dev tools, app backend - Devicons - DiFirebase - SVG | WEBP | PNG | JPG - Icon free download
DiFirebase
google analytics, ga, analytics, tracking, metrics, data, dashboard, charts, conversion, traffic, events, behavior, funnels, audience, web analytics, measurement, performance, reports, marketing, seo, ppc, insights, optimisation, tracking code, tag manager, platform, brand - Devicons - DiGoogleAnalytics - SVG | WEBP | PNG | JPG - Icon free download
DiGoogleAnalytics
google drive, drive, cloud storage, file storage, documents, sheets, slides, collaboration, sharing, backup, sync, workspace, folders, upload, download, file manager, brand, cloud, productivity, team, organization, web app, office suite - Devicons - DiGoogleDrive - SVG | WEBP | PNG | JPG - Icon free download
DiGoogleDrive
intellij, jetbrains, intellij idea, ide, code editor, java ide, developer tool, programming, coding, backend, frontend, workspace, editor, syntax, project, refactor, debug, android, android development, enterprise, build tool, code intelligence, productivity, software, dev environment, developer workflow, devops - Devicons - DiIntellij - SVG | WEBP | PNG | JPG - Icon free download
DiIntellij
jira, atlassian, project management, scrum, agile, kanban, tickets, issues, backlog, sprint, workflow, devops, collaboration, team board, product planning, task tracking, work items, epic, story, bug tracking, enterprise, productivity, dashboard - Devicons - DiJira - SVG | WEBP | PNG | JPG - Icon free download
DiJira
mailchimp, email marketing, automation, campaigns, newsletter, crm, audience management, segmentation, email tools, brand, chimp logo, marketing platform, customer engagement, templates, analytics - Devicons - DiMailchimp - SVG | WEBP | PNG | JPG - Icon free download
DiMailchimp
mssql, sql server, database, microsoft sql, relational db, rdbms, enterprise db, backend, data storage, server, data platform, sql, ado, orm, dotnet, cloud, enterprise apps, dashboard, devops, db admin, etl, data warehouse, analytics - Devicons - DiMsqlServer - SVG | WEBP | PNG | JPG - Icon free download
DiMsqlServer
mysql, sql, database, open source db, rdbms, backend, lamp stack, php, node, relational database, server, data storage, sql queries, schema, db admin, orm, analytics, etl, dashboard, dev tools - Devicons - DiMysql - SVG | WEBP | PNG | JPG - Icon free download
DiMysql
netbeans, ide, java ide, editor, developer tools, code editor, open source ide, project management, debugger, compiler, java development, plugins, workspace, coding, productivity, desktop ide - Devicons - DiNetbeans - SVG | WEBP | PNG | JPG - Icon free download
DiNetbeans
onedrive, microsoft, cloud storage, file sync, backup, drive, documents, sharing, collaboration, office365, productivity, cloud, file management, workspaces, syncing, remote access, storage service - Devicons - DiOnedrive - SVG | WEBP | PNG | JPG - Icon free download
DiOnedrive
postgresql, postgres, database, db, sql, rdbms, open source, structured data, backend, queries, developer tools, data storage, indexing, transactions, scalability, server, analytics, data ops, infrastructure, branding, logo - Devicons - DiPostgresql - SVG | WEBP | PNG | JPG - Icon free download
DiPostgresql
spark, apache spark, big data, data processing, cluster, hadoop, etl, data pipeline, analytics, machine learning, data engine, developer tool, backend, server processing, distributed computing, python spark, scala spark, data science, workflow, high performance - Devicons - DiSpark - SVG | WEBP | PNG | JPG - Icon free download
DiSpark
trello, brand, logo, kanban, board, task, task management, project management, collaboration, workflow, productivity, team work, cards, lists, scrum, agile, planning, tracker, tool logo, dashboard - Devicons - DiTrello - SVG | WEBP | PNG | JPG - Icon free download
DiTrello
visual studio, vs, microsoft, ide, editor, code editor, dev, developer tool, programming, csharp, dotnet, debug, compile, workspace, project, software, desktop app, coding tool, header icon, sidebar icon - Devicons - DiVisualstudio - SVG | WEBP | PNG | JPG - Icon free download
DiVisualstudio
angellist, angel list, startup, investor, funding, venture capital, vc, business, founder, entrepreneur, network, social platform, logo, brand, jobs, recruit, hire, team, company profile, navbar, footer, share - Font Awesome 5 - FaAngellist - SVG | WEBP | PNG | JPG - Icon free download
FaAngellist
asymmetrik, brand, tech company, enterprise, data, analytics, security, software, solutions, development, branding, logo, platform, api, integration, business, professional services, badge, button - Font Awesome 5 - FaAsymmetrik - SVG | WEBP | PNG | JPG - Icon free download
FaAsymmetrik
atlassian, jira, confluence, bitbucket, trello, collaboration, productivity, project management, devops, software development, workflow, teamwork, branding, enterprise, saas, tools, platform, organization, badge, logo - Font Awesome 5 - FaAtlassian - SVG | WEBP | PNG | JPG - Icon free download
FaAtlassian
aviato, brand, startup, tech company, fictional brand, marketing, logo, business, platform, community, identity, badge, symbol, button - Font Awesome 5 - FaAviato - SVG | WEBP | PNG | JPG - Icon free download
FaAviato
Tags
officeanalyticsuireportfiledocumentscreendatachartdashboarddisplaypresentationdevicestatsworkspacebusinessgraphmeetingoutlinefilledproductivitytoolbarmonitoreditorhardwarerecordbuttonlayoutandroidbrandiosbuildingstatisticsscheduleearmarkmobiledesktopwindowtaskmetricsfinancesheetpaperwebworklightclipboardformworkflowslidesbrightnessvideoattachmenttextpccomputerpropertyreminderdesignpptcollaborationtablebootstrapsettingspanelplannernotesdownloaddeckchatspreadsheetboardmediacityeaselinfrastructureprintworkstationexcelcallcalendarartsidebarlogoteamnotebriefcasejobcareersunstructurecommunicationeventcreative