CRUDIOS
wide screen, screen wide, monitor, display, widescreen, ultrawide, desktop, resolution, aspect ratio, landscape, tv, presentation, workspace, layout, frame, panel, ui frame, window, hardware, device - css.gg Icons - CgScreenWide - SVG | WEBP | PNG | JPG - Icon free download
cg/CgScreenWide

cg/CgScreenWide (css.gg Icons)

VS Code
1import { CgScreenWide } from "react-icons/cg";
2
3export default function Page(){
4  return <div><CgScreenWide/></div>
5}
Click To Copy (Free To Use)
Description
Line-style wide-screen display icon symbolizing a widescreen or ultra-wide monitor; suitable for device dashboards, layout previews, presentation tools, and system interfaces focused on display or resolution options.
Tags
wide screenscreen widemonitordisplaywidescreenultrawidedesktopresolutionaspect ratiolandscapetvpresentationworkspacelayoutframepanelui framewindowhardwaredevice
Categories
interfacedevicedisplaymediasystemlayoutdesktopmonitorscreenhardware
WEBP Download (256px)Customize & Download (HD)
Related Icons
control, adjust, settings, switch, manage, panel - Ant Design Icons - AiFillControl - SVG | WEBP | PNG | JPG - Icon free download
AiFillControl
dashboard, panel, metrics, overview, stats, control, monitor - Ant Design Icons - AiFillDashboard - SVG | WEBP | PNG | JPG - Icon free download
AiFillDashboard
ppt, presentation, slides, file, deck, powerpoint - Ant Design Icons - AiFillFilePpt - SVG | WEBP | PNG | JPG - Icon free download
AiFillFilePpt
hdd, drive, storage, disk, hardware, memory - Ant Design Icons - AiFillHdd - SVG | WEBP | PNG | JPG - Icon free download
AiFillHdd
layout, grid, design, dashboard, arrange, template - Ant Design Icons - AiFillLayout - SVG | WEBP | PNG | JPG - Icon free download
AiFillLayout
mobile, smartphone, phone, device, responsive, handset - Ant Design Icons - AiFillMobile - SVG | WEBP | PNG | JPG - Icon free download
AiFillMobile
picture, image, photo, gallery, media, landscape - Ant Design Icons - AiFillPicture - SVG | WEBP | PNG | JPG - Icon free download
AiFillPicture
printer, print, hardcopy, device, print-job, office - Ant Design Icons - AiFillPrinter - SVG | WEBP | PNG | JPG - Icon free download
AiFillPrinter
project, task, roadmap, milestone, plan, workspace - Ant Design Icons - AiFillProject - SVG | WEBP | PNG | JPG - Icon free download
AiFillProject
slack, brand, chat, team, workspace, circle, message, collab - Ant Design Icons - AiFillSlackCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillSlackCircle
slack, brand, chat, team, workspace, square, message, collab - Ant Design Icons - AiFillSlackSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillSlackSquare
tablet, device, screen, mobile, pad, touch, display - Ant Design Icons - AiFillTablet - SVG | WEBP | PNG | JPG - Icon free download
AiFillTablet
usb, port, connector, cable, hardware, peripheral - Ant Design Icons - AiFillUsb - SVG | WEBP | PNG | JPG - Icon free download
AiFillUsb
align, center, text, format, layout, outline - Ant Design Icons - AiOutlineAlignCenter - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAlignCenter
align, left, text, format, layout, outline - Ant Design Icons - AiOutlineAlignLeft - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAlignLeft
align, right, text, format, layout, outline - Ant Design Icons - AiOutlineAlignRight - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAlignRight
border, horizontal, line, format, layout, editor - Ant Design Icons - AiOutlineBorderHorizontal - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBorderHorizontal
border, inner, layout, frame, ui, design, table, cell - Ant Design Icons - AiOutlineBorderInner - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBorderInner
border, left, side, layout, ui, design, table, cell - Ant Design Icons - AiOutlineBorderLeft - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBorderLeft
border, outer, frame, layout, ui, design, table, cell - Ant Design Icons - AiOutlineBorderOuter - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBorderOuter
border, right, side, layout, ui, design, table, cell - Ant Design Icons - AiOutlineBorderRight - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBorderRight
border, top, layout, ui, design, table, cell - Ant Design Icons - AiOutlineBorderTop - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBorderTop
border, vertical, layout, ui, design, table, divider - Ant Design Icons - AiOutlineBorderVerticle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBorderVerticle
border, box, frame, layout, ui, design, container - Ant Design Icons - AiOutlineBorder - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBorder
table, borderless, grid, layout, ui, design, cells - Ant Design Icons - AiOutlineBorderlessTable - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBorderlessTable
column, height, resize, layout, table, grid, vertical - Ant Design Icons - AiOutlineColumnHeight - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineColumnHeight
column, width, resize, layout, spacing, ui, grid - Ant Design Icons - AiOutlineColumnWidth - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineColumnWidth
container, box, package, storage, block, layout, ui - Ant Design Icons - AiOutlineContainer - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineContainer
control, adjust, settings, tune, options, ui, panel - Ant Design Icons - AiOutlineControl - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineControl
dashboard, panel, overview, metrics, summary, admin - Ant Design Icons - AiOutlineDashboard - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDashboard
delete, column, table, remove, grid, layout, erase - Ant Design Icons - AiOutlineDeleteColumn - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDeleteColumn
delete, row, table, remove, grid, layout, erase - Ant Design Icons - AiOutlineDeleteRow - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDeleteRow
desktop, monitor, screen, pc, display, computer, workstation - Ant Design Icons - AiOutlineDesktop - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDesktop
file, ppt, presentation, slides, document, office, deck - Ant Design Icons - AiOutlineFilePpt - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFilePpt
fullscreen, exit, screen, close, view, window, shrink - Ant Design Icons - AiOutlineFullscreenExit - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFullscreenExit
fullscreen, expand, screen, view, window, maximize - Ant Design Icons - AiOutlineFullscreen - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFullscreen
fund, projection, screen, chart, presentation, finance, report - Ant Design Icons - AiOutlineFundProjectionScreen - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFundProjectionScreen
hdd, drive, storage, disk, hardware, data, memory - Ant Design Icons - AiOutlineHdd - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineHdd
insert, row, right, table, grid, add, layout, ui - Ant Design Icons - AiOutlineInsertRowRight - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineInsertRowRight
laptop, computer, device, work, desktop, hardware - Ant Design Icons - AiOutlineLaptop - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLaptop
layout, grid, structure, template, ui, design - Ant Design Icons - AiOutlineLayout - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLayout
merge, cells, table, grid, combine, spreadsheet, layout - Ant Design Icons - AiOutlineMergeCells - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMergeCells
mobile, phone, smartphone, device, handheld, screen, responsive - Ant Design Icons - AiOutlineMobile - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMobile
monitor, screen, display, desktop, computer, view, window - Ant Design Icons - AiOutlineMonitor - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMonitor
partition, split, divide, layout, section, separate - Ant Design Icons - AiOutlinePartition - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePartition
picture, center, align, image, layout, media, photo - Ant Design Icons - AiOutlinePicCenter - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePicCenter
picture, left, align, image, layout, media, photo - Ant Design Icons - AiOutlinePicLeft - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePicLeft
picture, right, align, image, layout, media, photo - Ant Design Icons - AiOutlinePicRight - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePicRight
printer, print, document, paper, office, device, output - Ant Design Icons - AiOutlinePrinter - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePrinter
slack, chat, team, collaboration, brand, workspace - Ant Design Icons - AiOutlineSlack - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSlack
split, cells, table, grid, layout, document, editing - Ant Design Icons - AiOutlineSplitCells - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSplitCells
table, grid, layout, cells, rows, columns, data - Ant Design Icons - AiOutlineTable - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTable
tablet, device, mobile, screen, electronics, touch, display - Ant Design Icons - AiOutlineTablet - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTablet
usb, flash drive, pendrive, storage, device, port - Ant Design Icons - AiOutlineUsb - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineUsb
align, bottom, vertical, text, layout, editor, format - Ant Design Icons - AiOutlineVerticalAlignBottom - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineVerticalAlignBottom
align, middle, vertical, center, layout, editor - Ant Design Icons - AiOutlineVerticalAlignMiddle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineVerticalAlignMiddle
align, top, vertical, layout, text, editor, format - Ant Design Icons - AiOutlineVerticalAlignTop - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineVerticalAlignTop
vertical, left, rotate, flip, sidebar, panel - Ant Design Icons - AiOutlineVerticalLeft - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineVerticalLeft
vertical, right, rotate, flip, sidebar, panel - Ant Design Icons - AiOutlineVerticalRight - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineVerticalRight
camera, photo, picture, image, media, capture, device, photography - Ant Design Icons - AiTwotoneCamera - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCamera
close, square, exit, cancel, error, stop, remove, window - Ant Design Icons - AiTwotoneCloseSquare - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCloseSquare
dashboard, panel, overview, stats, control, ui, summary - Ant Design Icons - AiTwotoneDashboard - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneDashboard
file, ppt, presentation, slides, document, office, format - Ant Design Icons - AiTwotoneFilePpt - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneFilePpt
hdd, drive, storage, disk, hardware, data - Ant Design Icons - AiTwotoneHdd - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneHdd
layout, grid, structure, template, design, ui - Ant Design Icons - AiTwotoneLayout - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneLayout
mobile, phone, smartphone, device, call, cell, handset - Ant Design Icons - AiTwotoneMobile - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneMobile
printer, print, document, paper, office, device, hardware - Ant Design Icons - AiTwotonePrinter - SVG | WEBP | PNG | JPG - Icon free download
AiTwotonePrinter
tablet, device, screen, mobile, touch, display - Ant Design Icons - AiTwotoneTablet - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneTablet
usb, connector, plug, port, hardware, transfer - Ant Design Icons - AiTwotoneUsb - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneUsb
align, justify, text, format, editor, layout - BoxIcons - BiAlignJustify - SVG | WEBP | PNG | JPG - Icon free download
BiAlignJustify
align, left, text, format, editor, layout - BoxIcons - BiAlignLeft - SVG | WEBP | PNG | JPG - Icon free download
BiAlignLeft
align, middle, center, text, format, layout - BoxIcons - BiAlignMiddle - SVG | WEBP | PNG | JPG - Icon free download
BiAlignMiddle
align, right, text, format, layout, editor - BoxIcons - BiAlignRight - SVG | WEBP | PNG | JPG - Icon free download
BiAlignRight
bluetooth, wireless, connect, pair, signal, device, tech - BoxIcons - BiBluetooth - SVG | WEBP | PNG | JPG - Icon free download
BiBluetooth
border, all, layout, grid, table, frame, outline - BoxIcons - BiBorderAll - SVG | WEBP | PNG | JPG - Icon free download
BiBorderAll
border, bottom, underline, layout, frame, style, format - BoxIcons - BiBorderBottom - SVG | WEBP | PNG | JPG - Icon free download
BiBorderBottom
border, inner, grid, layout, table, frame, format - BoxIcons - BiBorderInner - SVG | WEBP | PNG | JPG - Icon free download
BiBorderInner
border, left, layout, frame, style, format, design - BoxIcons - BiBorderLeft - SVG | WEBP | PNG | JPG - Icon free download
BiBorderLeft
border, none, layout, remove, format, style, design - BoxIcons - BiBorderNone - SVG | WEBP | PNG | JPG - Icon free download
BiBorderNone
border, outer, layout, frame, grid, design, format - BoxIcons - BiBorderOuter - SVG | WEBP | PNG | JPG - Icon free download
BiBorderOuter
border, right, layout, frame, format, style, design - BoxIcons - BiBorderRight - SVG | WEBP | PNG | JPG - Icon free download
BiBorderRight
border, top, layout, frame, format, design, style - BoxIcons - BiBorderTop - SVG | WEBP | PNG | JPG - Icon free download
BiBorderTop
brightness, half, light, adjust, display, screen, mode - BoxIcons - BiBrightnessHalf - SVG | WEBP | PNG | JPG - Icon free download
BiBrightnessHalf
brightness, light, sun, adjust, display, screen, mode - BoxIcons - BiBrightness - SVG | WEBP | PNG | JPG - Icon free download
BiBrightness
camera, home, security, cctv, monitor, surveillance, video - BoxIcons - BiCameraHome - SVG | WEBP | PNG | JPG - Icon free download
BiCameraHome
category, grid, menu, layout, sections, browse - BoxIcons - BiCategory - SVG | WEBP | PNG | JPG - Icon free download
BiCategory
cctv, camera, surveillance, monitor, security, watch - BoxIcons - BiCctv - SVG | WEBP | PNG | JPG - Icon free download
BiCctv
chalkboard, board, class, teach, school, presentation - BoxIcons - BiChalkboard - SVG | WEBP | PNG | JPG - Icon free download
BiChalkboard
chip, cpu, processor, hardware, technology, circuit - BoxIcons - BiChip - SVG | WEBP | PNG | JPG - Icon free download
BiChip
collapse, expand, toggle, panel, ui, menu - BoxIcons - BiCollapse - SVG | WEBP | PNG | JPG - Icon free download
BiCollapse
columns, layout, grid, section, split, design - BoxIcons - BiColumns - SVG | WEBP | PNG | JPG - Icon free download
BiColumns
desktop, monitor, screen, computer, pc, workstation, device - BoxIcons - BiDesktop - SVG | WEBP | PNG | JPG - Icon free download
BiDesktop
detail, details, view, info, expand, more, panel - BoxIcons - BiDetail - SVG | WEBP | PNG | JPG - Icon free download
BiDetail
devices, screens, monitor, tablet, phone, electronics, hardware - BoxIcons - BiDevices - SVG | WEBP | PNG | JPG - Icon free download
BiDevices
dock, bottom, layout, panel, ui, position - BoxIcons - BiDockBottom - SVG | WEBP | PNG | JPG - Icon free download
BiDockBottom
dock, left, layout, panel, ui, position - BoxIcons - BiDockLeft - SVG | WEBP | PNG | JPG - Icon free download
BiDockLeft
dock, right, layout, panel, ui, position - BoxIcons - BiDockRight - SVG | WEBP | PNG | JPG - Icon free download
BiDockRight
dock, top, layout, panel, ui, position - BoxIcons - BiDockTop - SVG | WEBP | PNG | JPG - Icon free download
BiDockTop
expand, horizontal, resize, stretch, arrows, ui, layout - BoxIcons - BiExpandHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BiExpandHorizontal
expand, vertical, resize, stretch, arrows, ui, layout - BoxIcons - BiExpandVertical - SVG | WEBP | PNG | JPG - Icon free download
BiExpandVertical
expand, resize, fullscreen, enlarge, arrows, ui, layout - BoxIcons - BiExpand - SVG | WEBP | PNG | JPG - Icon free download
BiExpand
fullscreen, expand, view, screen, maximize, display - BoxIcons - BiFullscreen - SVG | WEBP | PNG | JPG - Icon free download
BiFullscreen
grid, alt, layout, menu, tiles, dashboard, structure - BoxIcons - BiGridAlt - SVG | WEBP | PNG | JPG - Icon free download
BiGridAlt
grid, horizontal, layout, rows, structure, menu, tiles - BoxIcons - BiGridHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BiGridHorizontal
grid, small, layout, tiles, menu, structure, compact - BoxIcons - BiGridSmall - SVG | WEBP | PNG | JPG - Icon free download
BiGridSmall
grid, vertical, layout, columns, structure, menu, tiles - BoxIcons - BiGridVertical - SVG | WEBP | PNG | JPG - Icon free download
BiGridVertical
grid, layout, menu, tiles, structure, dashboard, matrix - BoxIcons - BiGrid - SVG | WEBP | PNG | JPG - Icon free download
BiGrid
hdd, hard-drive, storage, disk, device, memory, hardware - BoxIcons - BiHdd - SVG | WEBP | PNG | JPG - Icon free download
BiHdd
headphone, audio, music, sound, listen, media, device - BoxIcons - BiHeadphone - SVG | WEBP | PNG | JPG - Icon free download
BiHeadphone
horizontal, center, align, layout, position, design - BoxIcons - BiHorizontalCenter - SVG | WEBP | PNG | JPG - Icon free download
BiHorizontalCenter
horizontal, left, align, layout, position, design - BoxIcons - BiHorizontalLeft - SVG | WEBP | PNG | JPG - Icon free download
BiHorizontalLeft
horizontal, right, align, layout, position, design - BoxIcons - BiHorizontalRight - SVG | WEBP | PNG | JPG - Icon free download
BiHorizontalRight
joystick, game, controller, arcade, play, gaming, device - BoxIcons - BiJoystickAlt - SVG | WEBP | PNG | JPG - Icon free download
BiJoystickAlt
joystick, controller, game, arcade, gaming, device, control - BoxIcons - BiJoystick - SVG | WEBP | PNG | JPG - Icon free download
BiJoystick
landscape, scenery, photo, image, nature, view, picture - BoxIcons - BiLandscape - SVG | WEBP | PNG | JPG - Icon free download
BiLandscape
laptop, computer, pc, device, work, coding, technology - BoxIcons - BiLaptop - SVG | WEBP | PNG | JPG - Icon free download
BiLaptop
layer, minus, remove, subtract, stack, design, layout - BoxIcons - BiLayerMinus - SVG | WEBP | PNG | JPG - Icon free download
BiLayerMinus
layer, plus, add, stack, design, layout, increase - BoxIcons - BiLayerPlus - SVG | WEBP | PNG | JPG - Icon free download
BiLayerPlus
layer, stack, design, layout, group, arrange, structure - BoxIcons - BiLayer - SVG | WEBP | PNG | JPG - Icon free download
BiLayer
layout, grid, structure, ui, design, arrange, template - BoxIcons - BiLayout - SVG | WEBP | PNG | JPG - Icon free download
BiLayout
memory-card, storage, sd-card, data, device, media - BoxIcons - BiMemoryCard - SVG | WEBP | PNG | JPG - Icon free download
BiMemoryCard
microchip, chip, processor, hardware, cpu, electronics, circuit - BoxIcons - BiMicrochip - SVG | WEBP | PNG | JPG - Icon free download
BiMicrochip
mobile, alt, phone, smartphone, device, call, screen - BoxIcons - BiMobileAlt - SVG | WEBP | PNG | JPG - Icon free download
BiMobileAlt
mobile, landscape, phone, rotate, orientation, device, screen - BoxIcons - BiMobileLandscape - SVG | WEBP | PNG | JPG - Icon free download
BiMobileLandscape
mobile, vibration, phone, alert, notify, device, shake - BoxIcons - BiMobileVibration - SVG | WEBP | PNG | JPG - Icon free download
BiMobileVibration
mobile, phone, smartphone, device, call, screen, communication - BoxIcons - BiMobile - SVG | WEBP | PNG | JPG - Icon free download
BiMobile
mouse, alt, pointer, computer, input, device, navigation - BoxIcons - BiMouseAlt - SVG | WEBP | PNG | JPG - Icon free download
BiMouseAlt
mouse, computer, pointer, input, device, navigation, cursor - BoxIcons - BiMouse - SVG | WEBP | PNG | JPG - Icon free download
BiMouse
objects, horizontal, center, align, layout, position, ui, design - BoxIcons - BiObjectsHorizontalCenter - SVG | WEBP | PNG | JPG - Icon free download
BiObjectsHorizontalCenter
objects, horizontal, left, align, layout, position, ui, design - BoxIcons - BiObjectsHorizontalLeft - SVG | WEBP | PNG | JPG - Icon free download
BiObjectsHorizontalLeft
objects, horizontal, right, align, layout, position, ui, design - BoxIcons - BiObjectsHorizontalRight - SVG | WEBP | PNG | JPG - Icon free download
BiObjectsHorizontalRight
objects, vertical, bottom, align, layout, position, ui, design - BoxIcons - BiObjectsVerticalBottom - SVG | WEBP | PNG | JPG - Icon free download
BiObjectsVerticalBottom
objects, vertical, center, align, layout, position, ui, design - BoxIcons - BiObjectsVerticalCenter - SVG | WEBP | PNG | JPG - Icon free download
BiObjectsVerticalCenter
objects, vertical, top, align, layout, position, ui, design - BoxIcons - BiObjectsVerticalTop - SVG | WEBP | PNG | JPG - Icon free download
BiObjectsVerticalTop
phone, call, mobile, device, contact, dial - BoxIcons - BiPhone - SVG | WEBP | PNG | JPG - Icon free download
BiPhone
printer, print, document, paper, office, hardware - BoxIcons - BiPrinter - SVG | WEBP | PNG | JPG - Icon free download
BiPrinter
pulse, heartbeat, monitor, vitals, health, signal - BoxIcons - BiPulse - SVG | WEBP | PNG | JPG - Icon free download
BiPulse
rectangle, shape, box, border, frame, layout, geometry - BoxIcons - BiRectangle - SVG | WEBP | PNG | JPG - Icon free download
BiRectangle
sidebar, menu, panel, layout, navigation, ui - BoxIcons - BiSidebar - SVG | WEBP | PNG | JPG - Icon free download
BiSidebar
slideshow, presentation, slides, gallery, image, play - BoxIcons - BiSlideshow - SVG | WEBP | PNG | JPG - Icon free download
BiSlideshow
tab, panel, switch, navigation, ui, section - BoxIcons - BiTab - SVG | WEBP | PNG | JPG - Icon free download
BiTab
tv, television, screen, display, monitor, media - BoxIcons - BiTv - SVG | WEBP | PNG | JPG - Icon free download
BiTv
usb, connector, port, plug, hardware, drive, cable - BoxIcons - BiUsb - SVG | WEBP | PNG | JPG - Icon free download
BiUsb
vertical, bottom, align, layout, position, ui, arrange - BoxIcons - BiVerticalBottom - SVG | WEBP | PNG | JPG - Icon free download
BiVerticalBottom
vertical, center, align, layout, position, ui, arrange - BoxIcons - BiVerticalCenter - SVG | WEBP | PNG | JPG - Icon free download
BiVerticalCenter
vertical, top, align, position, layout, arrow, direction - BoxIcons - BiVerticalTop - SVG | WEBP | PNG | JPG - Icon free download
BiVerticalTop
webcam, camera, video, stream, record, device, webcam-icon - BoxIcons - BiWebcam - SVG | WEBP | PNG | JPG - Icon free download
BiWebcam
window, ui, app, panel, screen, layout, alt-window - BoxIcons - BiWindowAlt - SVG | WEBP | PNG | JPG - Icon free download
BiWindowAlt
window, close, exit, dismiss, ui, x, panel - BoxIcons - BiWindowClose - SVG | WEBP | PNG | JPG - Icon free download
BiWindowClose
window, open, expand, ui, panel, screen - BoxIcons - BiWindowOpen - SVG | WEBP | PNG | JPG - Icon free download
BiWindowOpen
window, ui, panel, screen, layout, app - BoxIcons - BiWindow - SVG | WEBP | PNG | JPG - Icon free download
BiWindow
windows, microsoft, os, brand, system, software, desktop - BoxIcons - BiWindows - SVG | WEBP | PNG | JPG - Icon free download
BiWindows
battery, charging, power, energy, device, charge - BoxIcons - BiSolidBatteryCharging - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBatteryCharging
battery, full, power, energy, charged, device - BoxIcons - BiSolidBatteryFull - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBatteryFull
battery, low, warning, power, energy, device, status - BoxIcons - BiSolidBatteryLow - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBatteryLow
battery, power, energy, level, device, status - BoxIcons - BiSolidBattery - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBattery
brightness, half, light, display, screen, adjust, level - BoxIcons - BiSolidBrightnessHalf - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBrightnessHalf
brightness, light, display, screen, adjust, sun, level - BoxIcons - BiSolidBrightness - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBrightness
camera, home, security, surveillance, monitor, cctv, smart-home - BoxIcons - BiSolidCameraHome - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCameraHome
chip, cpu, hardware, processor, electronics, board, component - BoxIcons - BiSolidChip - SVG | WEBP | PNG | JPG - Icon free download
BiSolidChip
dashboard, panel, stats, overview, control, analytics - BoxIcons - BiSolidDashboard - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDashboard
devices, monitor, tablet, phone, electronics, screens - BoxIcons - BiSolidDevices - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDevices
dock, bottom, panel, toolbar, layout, position - BoxIcons - BiSolidDockBottom - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDockBottom
dock, left, panel, toolbar, layout, position - BoxIcons - BiSolidDockLeft - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDockLeft
dock, right, panel, sidebar, layout, align, ui - BoxIcons - BiSolidDockRight - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDockRight
dock, top, panel, toolbar, header, layout, ui - BoxIcons - BiSolidDockTop - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDockTop
hdd, drive, storage, disk, hardware, device - BoxIcons - BiSolidHdd - SVG | WEBP | PNG | JPG - Icon free download
BiSolidHdd
keyboard, typing, input, device, computer, keys - BoxIcons - BiSolidKeyboard - SVG | WEBP | PNG | JPG - Icon free download
BiSolidKeyboard
landscape, photo, scenery, mountain, nature, background - BoxIcons - BiSolidLandscape - SVG | WEBP | PNG | JPG - Icon free download
BiSolidLandscape
layout, grid, template, ui, design, structure - BoxIcons - BiSolidLayout - SVG | WEBP | PNG | JPG - Icon free download
BiSolidLayout
memory-card, storage, sd-card, file, device, data - BoxIcons - BiSolidMemoryCard - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMemoryCard
microchip, chip, processor, hardware, cpu, tech, circuit - BoxIcons - BiSolidMicrochip - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMicrochip
mobile, phone, smartphone, device, call, handheld - BoxIcons - BiSolidMobile - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMobile
mouse, alt, pointer, device, cursor, input, computer - BoxIcons - BiSolidMouseAlt - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMouseAlt
mouse, pointer, cursor, input, device, click, computer - BoxIcons - BiSolidMouse - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMouse
align, horizontal, center, objects, layout, ui, position - BoxIcons - BiSolidObjectsHorizontalCenter - SVG | WEBP | PNG | JPG - Icon free download
BiSolidObjectsHorizontalCenter
align, horizontal, left, objects, layout, ui, position - BoxIcons - BiSolidObjectsHorizontalLeft - SVG | WEBP | PNG | JPG - Icon free download
BiSolidObjectsHorizontalLeft
align, horizontal, right, objects, layout, ui, position - BoxIcons - BiSolidObjectsHorizontalRight - SVG | WEBP | PNG | JPG - Icon free download
BiSolidObjectsHorizontalRight
align, vertical, bottom, objects, layout, ui, position - BoxIcons - BiSolidObjectsVerticalBottom - SVG | WEBP | PNG | JPG - Icon free download
BiSolidObjectsVerticalBottom
align, vertical, center, objects, layout, ui, position - BoxIcons - BiSolidObjectsVerticalCenter - SVG | WEBP | PNG | JPG - Icon free download
BiSolidObjectsVerticalCenter
align, vertical, top, objects, layout, ui, position - BoxIcons - BiSolidObjectsVerticalTop - SVG | WEBP | PNG | JPG - Icon free download
BiSolidObjectsVerticalTop
phone, mobile, call, contact, device, communication, dial - BoxIcons - BiSolidPhone - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPhone
plug, power, connect, socket, adapter, electric, device - BoxIcons - BiSolidPlug - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPlug
printer, print, device, paper, document, office, output - BoxIcons - BiSolidPrinter - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPrinter
rectangle, shape, box, block, layout, container - BoxIcons - BiSolidRectangle - SVG | WEBP | PNG | JPG - Icon free download
BiSolidRectangle
slideshow, presentation, images, gallery, display, media - BoxIcons - BiSolidSlideshow - SVG | WEBP | PNG | JPG - Icon free download
BiSolidSlideshow
tv, television, screen, display, monitor, media - BoxIcons - BiSolidTv - SVG | WEBP | PNG | JPG - Icon free download
BiSolidTv
user, rectangle, frame, profile, account, avatar, id - BoxIcons - BiSolidUserRectangle - SVG | WEBP | PNG | JPG - Icon free download
BiSolidUserRectangle
window, alt, app, panel, screen, ui - BoxIcons - BiSolidWindowAlt - SVG | WEBP | PNG | JPG - Icon free download
BiSolidWindowAlt
apple, ios, mac, brand, tech, device - BoxIcons - BiLogoApple - SVG | WEBP | PNG | JPG - Icon free download
BiLogoApple
slack, team, chat, workspace, messages, old - BoxIcons - BiLogoSlackOld - SVG | WEBP | PNG | JPG - Icon free download
BiLogoSlackOld
slack, team, chat, workspace, messages, collab - BoxIcons - BiLogoSlack - SVG | WEBP | PNG | JPG - Icon free download
BiLogoSlack
windows, microsoft, os, system, pc, desktop, software - BoxIcons - BiLogoWindows - SVG | WEBP | PNG | JPG - Icon free download
BiLogoWindows
aspect, ratio, resize, scale, fit, layout - Bootstrap Icons - BsFillAspectRatioFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillAspectRatioFill
brightness, high, alt, light, screen, display, sun, level - Bootstrap Icons - BsFillBrightnessAltHighFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBrightnessAltHighFill
brightness, low, alt, light, dim, screen, display, level - Bootstrap Icons - BsFillBrightnessAltLowFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBrightnessAltLowFill
brightness, high, light, screen, display, sun, level, adjust - Bootstrap Icons - BsFillBrightnessHighFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBrightnessHighFill
brightness, low, dim, light, screen, display, level, adjust - Bootstrap Icons - BsFillBrightnessLowFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBrightnessLowFill
clipboard, pulse, health, monitor, vitals, record, medical - Bootstrap Icons - BsFillClipboard2PulseFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillClipboard2PulseFill
cpu, processor, chip, hardware, computer, performance - Bootstrap Icons - BsFillCpuFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCpuFill
hdd, hard drive, storage, device, disk, hardware - Bootstrap Icons - BsFillDeviceHddFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDeviceHddFill
ssd, solid state drive, storage, device, disk, hardware - Bootstrap Icons - BsFillDeviceSsdFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDeviceSsdFill
display, monitor, screen, desktop, computer, device - Bootstrap Icons - BsFillDisplayFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDisplayFill
displayport, port, connector, monitor, video, cable - Bootstrap Icons - BsFillDisplayportFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDisplayportFill
easel, board, presentation, art, display, teaching - Bootstrap Icons - BsFillEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillEaselFill
easel, board, presentation, art, drawing, display - Bootstrap Icons - BsFillEasel2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillEasel2Fill
easel, board, presentation, art, creative, display - Bootstrap Icons - BsFillEasel3Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillEasel3Fill
file, easel, presentation, board, teaching, document, slide - Bootstrap Icons - BsFillFileEarmarkEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkEaselFill
file, ppt, powerpoint, slides, presentation, document, deck - Bootstrap Icons - BsFillFileEarmarkPptFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkPptFill
file, slides, presentation, deck, ppt, document, teaching - Bootstrap Icons - BsFillFileEarmarkSlidesFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkSlidesFill
file, easel, presentation, board, teacher, document, lecture - Bootstrap Icons - BsFillFileEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEaselFill
file, ppt, presentation, slides, powerpoint, document - Bootstrap Icons - BsFillFilePptFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFilePptFill
file, slides, presentation, deck, ppt, document - Bootstrap Icons - BsFillFileSlidesFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileSlidesFill
grid, layout, columns, structure, panel, sections - Bootstrap Icons - BsFillGrid1X2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillGrid1X2Fill
grid, layout, 3x2, gap, structure, tiles - Bootstrap Icons - BsFillGrid3X2GapFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillGrid3X2GapFill
grid, layout, 3x3, gap, structure, matrix - Bootstrap Icons - BsFillGrid3X3GapFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillGrid3X3GapFill
grid, layout, tiles, matrix, structure, dashboard - Bootstrap Icons - BsFillGridFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillGridFill
hdd, drive, storage, disk, hardware, data - Bootstrap Icons - BsFillHddFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillHddFill
hdd, network, storage, server, nas, hardware, data - Bootstrap Icons - BsFillHddNetworkFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillHddNetworkFill
hdd, rack, server, hardware, storage, datacenter - Bootstrap Icons - BsFillHddRackFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillHddRackFill
hdd, stack, storage, drives, hardware, data - Bootstrap Icons - BsFillHddStackFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillHddStackFill
hdmi, cable, port, display, connector, video - Bootstrap Icons - BsFillHdmiFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillHdmiFill
heart, pulse, heartbeat, health, medical, monitor - Bootstrap Icons - BsFillHeartPulseFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillHeartPulseFill
keyboard, typing, input, device, keys, pc, hardware - Bootstrap Icons - BsFillKeyboardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillKeyboardFill
lamp, light, desk, illumination, bulb, home, workspace - Bootstrap Icons - BsFillLampFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillLampFill
laptop, computer, pc, notebook, work, hardware, portable - Bootstrap Icons - BsFillLaptopFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillLaptopFill
menu, wide, button, options, toggle, panel, ui - Bootstrap Icons - BsFillMenuButtonWideFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMenuButtonWideFill
modem, internet, network, router, connection, hardware, signal - Bootstrap Icons - BsFillModemFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillModemFill
motherboard, hardware, circuit, pc, tech, chip, electronics - Bootstrap Icons - BsFillMotherboardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMotherboardFill
mouse, pointer, cursor, input, hardware, pc, device - Bootstrap Icons - BsFillMouseFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMouseFill
mouse, mouse2, pointer, cursor, input, hardware, pc - Bootstrap Icons - BsFillMouse2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMouse2Fill
mouse, input, scroll, device, pointer, hardware - Bootstrap Icons - BsFillMouse3Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMouse3Fill
nut, bolt, hardware, fastener, mechanical, tool - Bootstrap Icons - BsFillNutFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillNutFill
nvme, storage, ssd, drive, hardware, memory - Bootstrap Icons - BsFillNvmeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillNvmeFill
phone, call, mobile, telephone, contact, device, handset - Bootstrap Icons - BsFillPhoneFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPhoneFill
phone, landscape, rotate, orientation, mobile, device, screen - Bootstrap Icons - BsFillPhoneLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPhoneLandscapeFill
phone, vibrate, alert, mobile, silent, notify, device - Bootstrap Icons - BsFillPhoneVibrateFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPhoneVibrateFill
pip, picture-in-picture, video, window, overlay, player - Bootstrap Icons - BsFillPipFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPipFill
printer, print, device, paper, office, document, hardware - Bootstrap Icons - BsFillPrinterFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPrinterFill
projector, presentation, screen, display, video, device, project - Bootstrap Icons - BsFillProjectorFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillProjectorFill
router, wifi, network, internet, modem, signal, connect, lan, ethernet, wireless, iot, device, broadband, network-device - Bootstrap Icons - BsFillRouterFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRouterFill
sd, sd-card, memory-card, storage, flash, device, hardware, media, camera-card, portable-storage, data, transfer, backup - Bootstrap Icons - BsFillSdCardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSdCardFill
sim, card, sim-card, chip, mobile, network, cellular, telecom, carrier, data, 4g, 5g, device, hardware, slot, communication, connectivity, phone, smartphone - Bootstrap Icons - BsFillSimFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSimFill
sim, slash, sim-slash, no-sim, sim-card, mobile, cellular, network-off, connectivity, disabled, error, warning, alert, blocked, restricted, signal, device, smartphone, gsm, lte, offline, settings, status-icon, ui-indicator - Bootstrap Icons - BsFillSimSlashFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSimSlashFill
speaker, audio, sound, volume, loud, media, output, device, music, voice, alert, announcement, notification, speaker-icon, sound-output, media-control - Bootstrap Icons - BsFillSpeakerFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSpeakerFill
stickies, sticky-notes, notes, memo, post-it, reminder, note-stack, note-board, task, todo, workspace, dashboard, widget, panel, collaboration, annotation, pinned, organizer, productivity, ui-element, button, svg, filled, stationery - Bootstrap Icons - BsFillStickiesFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStickiesFill
tablet, device, mobile, screen, touchscreen, electronics, gadget, smart-device, ipad, android-tablet, responsive, layout, interface, technology, media-device - Bootstrap Icons - BsFillTabletFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTabletFill
tablet, landscape, device, horizontal, screen, touchscreen, electronics, responsive, orientation, media, ipad, android-tablet, layout, interface - Bootstrap Icons - BsFillTabletLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTabletLandscapeFill
tree, forest, plant, nature, eco, environment, green, outdoor, growth, leaf, wood, landscape, ui - Bootstrap Icons - BsFillTreeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTreeFill
triangle, shape, geometry, symbol, pointer, direction, polygon, ui, icon, layout, design, vector - Bootstrap Icons - BsFillTriangleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTriangleFill
tv, television, screen, monitor, display, media, video, entertainment, electronics, device, smart-tv, home, ui - Bootstrap Icons - BsFillTvFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTvFill
usb, usb-c, connector, type-c, port, cable, data-transfer, charging, hardware, device, technology, interface - Bootstrap Icons - BsFillUsbCFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbCFill
usb-drive, flash-drive, pendrive, storage, usb, device, data, file-transfer, backup, hardware, portable-storage - Bootstrap Icons - BsFillUsbDriveFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbDriveFill
usb, connector, port, drive, cable, technology, hardware, data-transfer, charging, device, interface - Bootstrap Icons - BsFillUsbFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbFill
usb, microusb, micro-usb, connector, port, cable, charging, data-transfer, hardware, device, legacy-port - Bootstrap Icons - BsFillUsbMicroFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbMicroFill
usb, mini, usb-mini, port, connector, plug, hardware, device, io, cable, data, transfer, charging, sync, peripheral, electronics, connection, interface, port-type, mobile-accessory, adapter, sidebar, footer, settings, toolbar - Bootstrap Icons - BsFillUsbMiniFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbMiniFill
usb, plug, usb-plug, connector, cable, hardware, device, io, peripheral, charging, sync, data-transfer, power, port, adapter, electronics, connection, wired, settings, toolbar, footer - Bootstrap Icons - BsFillUsbPlugFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbPlugFill
webcam, camera, video, stream, live, record, conference, meeting, call, online-class, monitoring, security-cam, device, hardware, lens, capture, broadcast, chat, video-call, toolbar - Bootstrap Icons - BsFillWebcamFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillWebcamFill
wrench, adjustable, tool, adjustable-wrench, circle, settings, maintenance, fix, repair, mechanic, configure, hardware, system, utilities, toolbar, preferences, setup, gear-alt - Bootstrap Icons - BsFillWrenchAdjustableCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillWrenchAdjustableCircleFill
reverse, layout, sidebar, inset, reverse-layout, sidebar-inset, ui, interface, web-layout, panel, navigation, columns, page-structure, template, responsive, design, dashboard, left-sidebar, right-sidebar - Bootstrap Icons - BsReverseLayoutSidebarInsetReverse - SVG | WEBP | PNG | JPG - Icon free download
BsReverseLayoutSidebarInsetReverse
reverse, layout, sidebar, reverse-layout, panel, navigation, columns, structure, template, ui, interface, responsive, design, web-layout, builder, toggle-sidebar - Bootstrap Icons - BsReverseLayoutSidebarReverse - SVG | WEBP | PNG | JPG - Icon free download
BsReverseLayoutSidebarReverse
reverse, layout, text, sidebar, text-sidebar, reverse-layout, panel, columns, ui, interface, typography-layout, content, template, web-layout, design, builder - Bootstrap Icons - BsReverseLayoutTextSidebarReverse - SVG | WEBP | PNG | JPG - Icon free download
BsReverseLayoutTextSidebarReverse
reverse, layout, text, window, reverse-layout, mirror, flip, rtl, ltr, ui-layout, content-window, panel, sidebar, page-structure, document-layout, editor, web-design, frontend, component, responsive, grid, toggle, settings - Bootstrap Icons - BsReverseLayoutTextWindowReverse - SVG | WEBP | PNG | JPG - Icon free download
BsReverseLayoutTextWindowReverse
reverse, list, columns, reverse-columns, grid, layout, column-order, flip, mirror, ui, table, spreadsheet, data-layout, sort, arrange, edit, settings, panel, structure - Bootstrap Icons - BsReverseListColumnsReverse - SVG | WEBP | PNG | JPG - Icon free download
BsReverseListColumnsReverse
8, eight, number, digit, square, 8-square, numeric, counter, label, tile, box, ui, badge, button, grid, layout - Bootstrap Icons - Bs8SquareFill - SVG | WEBP | PNG | JPG - Icon free download
Bs8SquareFill
activity, heartbeat, pulse, monitor, analytics, chart, signal, graph, tracking, performance, health, status, monitoring, metric - Bootstrap Icons - BsActivity - SVG | WEBP | PNG | JPG - Icon free download
BsActivity
align, bottom, align-bottom, layout, editor, toolbar, design, format, positioning, ui, content - Bootstrap Icons - BsAlignBottom - SVG | WEBP | PNG | JPG - Icon free download
BsAlignBottom
align, center, align-center, layout, editor, toolbar, format, design, positioning, ui, content - Bootstrap Icons - BsAlignCenter - SVG | WEBP | PNG | JPG - Icon free download
BsAlignCenter
align, end, align-end, justify-end, right-align, layout, content-alignment, editor, formatting, ui, toolbar, web, css, grid, flex, paragraph, text, component, alignment-tool, horizontal-align - Bootstrap Icons - BsAlignEnd - SVG | WEBP | PNG | JPG - Icon free download
BsAlignEnd
align, middle, align-middle, center-align, vertical-align, layout, content-position, formatting, typography, ui, grid, flex, text, editor, center - Bootstrap Icons - BsAlignMiddle - SVG | WEBP | PNG | JPG - Icon free download
BsAlignMiddle
align, start, align-start, left-align, justify-start, layout, format, text, ui, flex, grid, writing, position, content-align - Bootstrap Icons - BsAlignStart - SVG | WEBP | PNG | JPG - Icon free download
BsAlignStart
align, top, align-top, vertical-align, top-position, layout, ui, formatting, editor, content-align, grid, flex, component - Bootstrap Icons - BsAlignTop - SVG | WEBP | PNG | JPG - Icon free download
BsAlignTop
amd, brand, processor, cpu, gpu, hardware, chip, computing, tech, electronics, ryzen, radeon, semiconductor - Bootstrap Icons - BsAmd - SVG | WEBP | PNG | JPG - Icon free download
BsAmd
apple, ios, mac, macos, iphone, brand, tech, hardware, company, device, store, app-store - Bootstrap Icons - BsApple - SVG | WEBP | PNG | JPG - Icon free download
BsApple
arrow, left, 90deg, rotate-left, turn-left, direction, navigation, ui, interface, pointer, cursor, button, sidebar, back, previous, undo, layout, ios, android, web, header, footer, action, navigate-left - Bootstrap Icons - BsArrow90DegLeft - SVG | WEBP | PNG | JPG - Icon free download
BsArrow90DegLeft
arrow, right, 90deg, rotate-right, turn-right, direction, navigation, ui, pointer, cursor, button, next, forward, layout, toolbar, sidebar, navigate-right, ios, android, web - Bootstrap Icons - BsArrow90DegRight - SVG | WEBP | PNG | JPG - Icon free download
BsArrow90DegRight
arrow, left, bar, arrow-bar-left, sidebar, collapse-left, navigation, ui, pointer, cursor, previous, back, toolbar, panel, navigate-left - Bootstrap Icons - BsArrowBarLeft - SVG | WEBP | PNG | JPG - Icon free download
BsArrowBarLeft
arrow, right, bar, arrow-bar-right, sidebar-open, expand-right, navigation, ui, pointer, cursor, next, forward, toolbar, panel, navigate-right - Bootstrap Icons - BsArrowBarRight - SVG | WEBP | PNG | JPG - Icon free download
BsArrowBarRight
arrow, up, bar, arrow-bar-up, expand-up, scroll-up, navigation, ui, cursor, pointer, toolbar, panel, navigate-up - Bootstrap Icons - BsArrowBarUp - SVG | WEBP | PNG | JPG - Icon free download
BsArrowBarUp
arrow, down-left, direction, navigate, diagonal, ui, pointer, cursor, transition, layout, toolbar, move, shift - Bootstrap Icons - BsArrowDownLeft - SVG | WEBP | PNG | JPG - Icon free download
BsArrowDownLeft
arrow, down, right, down-right, circle, direction, navigate, movement, pointer, ui, button, icon, shift, diagonal, control, next, forward, corner, layout, android, ios, web, hover, active - Bootstrap Icons - BsArrowDownRightCircle - SVG | WEBP | PNG | JPG - Icon free download
BsArrowDownRightCircle
arrow, down, right, down-right, square, filled, direction, navigate, pointer, shift, diagonal, layout, button, ui, press, forward, move, indicator - Bootstrap Icons - BsArrowDownRightSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsArrowDownRightSquareFill
arrow, right, square, fill, arrow-right, right-square, navigate, forward, next, ui, button, tile, panel, menu, grid, layout, step, move, solid-arrow - Bootstrap Icons - BsArrowRightSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsArrowRightSquareFill
arrow, up, left, up-left, square, fill, tile, navigate, diagonal, ui, button, grid, panel, move - Bootstrap Icons - BsArrowUpLeftSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsArrowUpLeftSquareFill
arrow, up, square, filled, arrow-up, arrow-square, navigate, button, tile, layout, panel, move-up, upload, indicator, action, ui, dashboard, menu, android, ios, web - Bootstrap Icons - BsArrowUpSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsArrowUpSquareFill
arrow, up, square, outline, arrow-up, arrow-square, navigate, move-up, upload, indicator, panel, tile, ui, button, card, android, ios, web - Bootstrap Icons - BsArrowUpSquare - SVG | WEBP | PNG | JPG - Icon free download
BsArrowUpSquare
arrows, contract, angle, arrows-angle-contract, shrink, collapse, reduce, resize, minimize, ui, panel, window, layout, grid, movement, interaction, android, ios, web - Bootstrap Icons - BsArrowsAngleContract - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsAngleContract
arrows, expand, angle, arrows-angle-expand, grow, enlarge, maximize, resize, fullscreen, ui, panel, window, layout, grid, movement, android, ios, web - Bootstrap Icons - BsArrowsAngleExpand - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsAngleExpand
arrows, collapse, vertical, arrows-collapse-vertical, shrink, compress, ui, panel, window, movement, resize, vertical-resize, vertical-collapse, toolbar, android, ios, web - Bootstrap Icons - BsArrowsCollapseVertical - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsCollapseVertical
arrows, collapse, arrows-collapse, shrink, compress, reduce, resize, ui, panel, window, movement, interaction, toolbar, android, ios, web - Bootstrap Icons - BsArrowsCollapse - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsCollapse
arrows, expand, vertical, arrows-expand-vertical, grow, enlarge, vertical-resize, fullscreen, ui, panel, window, movement, toolbar, android, ios, web - Bootstrap Icons - BsArrowsExpandVertical - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsExpandVertical
arrows, expand, arrows-expand, grow, enlarge, maximize, fullscreen, resize, ui, panel, window, movement, grid, layout, android, ios, web - Bootstrap Icons - BsArrowsExpand - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsExpand
arrows, fullscreen, expand, maximize, full-screen, screen, display, ui, player, video, view, enlarge, panel, window, android, ios, web - Bootstrap Icons - BsArrowsFullscreen - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsFullscreen
arrows, move, arrows-move, drag, reposition, cursor, move-tool, pan, shift, layout, grid, ui, interaction, pointer, android, ios, web - Bootstrap Icons - BsArrowsMove - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsMove
arrows, direction, multi-direction, navigate, pointer, move, drag, ui-control, layout, symbol - Bootstrap Icons - BsArrows - SVG | WEBP | PNG | JPG - Icon free download
BsArrows
badge, 3d, three-dimensional, filled, video, media, sticker, label, tag, display, resolution, quality, banner, promo, card - Bootstrap Icons - BsBadge3dFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadge3dFill
badge, 3d, three-dimensional, outline, media, video, label, tag, sticker, resolution, quality, display, promo - Bootstrap Icons - BsBadge3D - SVG | WEBP | PNG | JPG - Icon free download
BsBadge3D
badge, 4k, ultra-hd, uhd, video, resolution, quality, media, display, label, sticker, promo, filled - Bootstrap Icons - BsBadge4kFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadge4kFill
badge, 4k, ultra-hd, uhd, resolution, video, media, display, tag, label, sticker, quality, outline - Bootstrap Icons - BsBadge4K - SVG | WEBP | PNG | JPG - Icon free download
BsBadge4K
badge, 8k, ultra-hd, uhd, super-high-resolution, video, media, display, quality, label, sticker, promo, filled - Bootstrap Icons - BsBadge8kFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadge8kFill
badge, 8k, ultra-hd, uhd, video, resolution, media, quality, display, sticker, tag, outline - Bootstrap Icons - BsBadge8K - SVG | WEBP | PNG | JPG - Icon free download
BsBadge8K
badge, hd, high-definition, video, quality, filled, label, tag, media, display, resolution, streaming, hd-icon, indicator, player, ui - Bootstrap Icons - BsBadgeHdFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeHdFill
badge, hd, high-definition, outline, video, quality, media, streaming, resolution, display, label, tag, indicator, player, hd-icon - Bootstrap Icons - BsBadgeHd - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeHd
badge, sd, standard-definition, filled, video, quality, media, resolution, display, streaming, label, tag, indicator, player, sd-icon - Bootstrap Icons - BsBadgeSdFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeSdFill
badge, sd, standard-definition, outline, video, quality, media, streaming, resolution, display, label, tag, indicator, player, sd-label - Bootstrap Icons - BsBadgeSd - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeSd
battery, charging, power, charge, electric, energy, device, low-power, high-power, status, indicator, system, electronics, hardware, lightning, ui, toolbar - Bootstrap Icons - BsBatteryCharging - SVG | WEBP | PNG | JPG - Icon free download
BsBatteryCharging
battery, full, charged, power, energy, device, system, indicator, high-battery, hardware, ui, toolbar, status - Bootstrap Icons - BsBatteryFull - SVG | WEBP | PNG | JPG - Icon free download
BsBatteryFull
battery, half, medium, charge, power, energy, device, indicator, system, hardware, ui, toolbar - Bootstrap Icons - BsBatteryHalf - SVG | WEBP | PNG | JPG - Icon free download
BsBatteryHalf
battery, power, charge, energy, device, system, indicator, hardware, status, toolbar, outline - Bootstrap Icons - BsBattery - SVG | WEBP | PNG | JPG - Icon free download
BsBattery
bluetooth, wireless, connection, pair, device, network, mobile, tech, signal, connect, iot, transfer, communication, ui - Bootstrap Icons - BsBluetooth - SVG | WEBP | PNG | JPG - Icon free download
BsBluetooth
border, all, grid, table, cells, layout, outline, box, frame, table-border, editor, formatting, toolbar, button, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderAll - SVG | WEBP | PNG | JPG - Icon free download
BsBorderAll
border, bottom, underline, table, row, cells, formatting, layout, box, frame, editor, toolbar, button, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderBottom - SVG | WEBP | PNG | JPG - Icon free download
BsBorderBottom
border, center, alignment, grid, cells, formatting, layout, table, editor, toolbar, button, align-center, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderCenter - SVG | WEBP | PNG | JPG - Icon free download
BsBorderCenter
border, inner, grid, cells, table, layout, formatting, editor, frame, box, toolbar, button, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderInner - SVG | WEBP | PNG | JPG - Icon free download
BsBorderInner
border, left, alignment, table, column, cells, formatting, layout, editor, toolbar, button, align-left, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderLeft - SVG | WEBP | PNG | JPG - Icon free download
BsBorderLeft
border, middle, center, grid, cells, table, layout, formatting, editor, toolbar, button, align-center, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderMiddle - SVG | WEBP | PNG | JPG - Icon free download
BsBorderMiddle
border, outer, frame, box, container, layout, table, cells, formatting, editor, toolbar, button, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderOuter - SVG | WEBP | PNG | JPG - Icon free download
BsBorderOuter
border, right, border-right, layout, css, design, ui, editor, frame, container, alignment, sidebar, panel, divider, stroke, outline, tool, button, hover, active, web, android, ios - Bootstrap Icons - BsBorderRight - SVG | WEBP | PNG | JPG - Icon free download
BsBorderRight
border, style, border-style, dotted, dashed, solid, css, ui, layout, stroke, outline, editor, styling, design-tool, formating, button, hover, panel, toolbar, web, mobile - Bootstrap Icons - BsBorderStyle - SVG | WEBP | PNG | JPG - Icon free download
BsBorderStyle
border, top, border-top, layout, css, frame, outline, stroke, alignment, editor, design, ui, toolbar, panel, hover, button, web, mobile - Bootstrap Icons - BsBorderTop - SVG | WEBP | PNG | JPG - Icon free download
BsBorderTop
border, width, border-width, thickness, stroke, line-weight, css, editor, design, ui, layout, panel, styling, hover, button, toolbar, web, android, ios - Bootstrap Icons - BsBorderWidth - SVG | WEBP | PNG | JPG - Icon free download
BsBorderWidth
border, frame, outline, stroke, box, container, layout, css, ui, editor, styling, panel, hover, button, toolbar, web, app - Bootstrap Icons - BsBorder - SVG | WEBP | PNG | JPG - Icon free download
BsBorder
bounding, box, circles, bounding-box, transform, resize, drag, handles, editor, design, ui, element, crop, selection, move, frame, tool, graphics, hover - Bootstrap Icons - BsBoundingBoxCircles - SVG | WEBP | PNG | JPG - Icon free download
BsBoundingBoxCircles
bounding, box, bounding-box, frame, selection, crop, outline, design, editor, ui, graphics, positioning, drag, transform, move, resize, tool - Bootstrap Icons - BsBoundingBox - SVG | WEBP | PNG | JPG - Icon free download
BsBoundingBox
box, arrow, down, left, box-arrow-down-left, export, download, out, move, direction, navigation, ui, action, workflow, panel, file, button, hover - Bootstrap Icons - BsBoxArrowDownLeft - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowDownLeft
box, arrow, down, right, box-arrow-down-right, export, download, move, direction, ui, navigation, workflow, file, button, hover, panel - Bootstrap Icons - BsBoxArrowDownRight - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowDownRight
box, arrow, down, box-arrow-down, download, import, direction, move, ui, workflow, file, panel, button, hover, storage - Bootstrap Icons - BsBoxArrowDown - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowDown
box, arrow, in, down, left, box-arrow-in-down-left, import, download, move, direction, ui, workflow, file, panel, action - Bootstrap Icons - BsBoxArrowInDownLeft - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInDownLeft
box, arrow, in, down, right, box-arrow-in-down-right, import, download, move, direction, ui, workflow, file, panel, button - Bootstrap Icons - BsBoxArrowInDownRight - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInDownRight
box, arrow, in, down, box-arrow-in-down, import, download, direction, ui, workflow, file, panel, button, hover - Bootstrap Icons - BsBoxArrowInDown - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInDown
box, arrow, in, left, box-arrow-in-left, import, move, direction, ui, workflow, file, panel, action, hover - Bootstrap Icons - BsBoxArrowInLeft - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInLeft
box, arrow, in, right, box-arrow-in-right, import, direction, move, ui, workflow, file, panel, button, hover - Bootstrap Icons - BsBoxArrowInRight - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInRight
bricks, brick-wall, construction, blocks, structure, foundation, grid, layout, build, pattern, wall, masonry, design, stack, components - Bootstrap Icons - BsBricks - SVG | WEBP | PNG | JPG - Icon free download
BsBricks
brightness, high, sun, light, display, screen, settings, contrast, visibility, level, ui-control, adjustment, day-mode - Bootstrap Icons - BsBrightnessAltHighFill - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessAltHighFill
brightness, high, sun, light, display, screen, settings, contrast, visibility, day-mode, ui-control, icon-outline - Bootstrap Icons - BsBrightnessAltHigh - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessAltHigh
brightness, low, sun, dim, light, display, screen, settings, contrast, night-mode, level, adjustment - Bootstrap Icons - BsBrightnessAltLowFill - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessAltLowFill
brightness, low, sun, dim, light, display, screen, settings, contrast, night-mode, ui-control - Bootstrap Icons - BsBrightnessAltLow - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessAltLow
brightness, high, light, sun, display, screen, settings, contrast, day-mode, adjustment - Bootstrap Icons - BsBrightnessHighFill - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessHighFill
brightness, high, light, sun, display, screen, settings, contrast, day-mode, ui-control - Bootstrap Icons - BsBrightnessHigh - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessHigh
brightness, low, dim, light, sun, display, screen, settings, contrast, adjustment, night-mode - Bootstrap Icons - BsBrightnessLowFill - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessLowFill
brightness, low, dim, sun, light, display, screen, settings, contrast, ui-control - Bootstrap Icons - BsBrightnessLow - SVG | WEBP | PNG | JPG - Icon free download
BsBrightnessLow
brilliance, brightness, shine, glow, light, illumination, display, screen, settings, contrast, ui-adjustment - Bootstrap Icons - BsBrilliance - SVG | WEBP | PNG | JPG - Icon free download
BsBrilliance
browser, firefox, mozilla, web, internet, tabs, navigation, search, engine, homepage, ui, toolbar, app, software, window, web-app, bookmark, address-bar, security, open-source, brand - Bootstrap Icons - BsBrowserFirefox - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserFirefox
browser, safari, apple, apple-browser, web, internet, search, engine, navigation, tabs, bookmark, ui, toolbar, macos, ios, window, web-app, address-bar, brand - Bootstrap Icons - BsBrowserSafari - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserSafari
card, heading, title, header, text, content-block, ui-card, section-heading, layout, label - Bootstrap Icons - BsCardHeading - SVG | WEBP | PNG | JPG - Icon free download
BsCardHeading
cast, screen-cast, stream, streaming, connect, wireless, airplay, chromecast, mirroring, display, device, tv-out, multimedia, presentation, wifi, project - Bootstrap Icons - BsCast - SVG | WEBP | PNG | JPG - Icon free download
BsCast
chevron, bar, contract, collapse, fold, close-section, shrink, reduce, toggle, arrow, nav, ui, panel, accordion, sidebar, compact, ios, android - Bootstrap Icons - BsChevronBarContract - SVG | WEBP | PNG | JPG - Icon free download
BsChevronBarContract
chevron, bar, expand, open, unfold, enlarge, show-more, toggle, nav, ui, panel, accordion, section - Bootstrap Icons - BsChevronBarExpand - SVG | WEBP | PNG | JPG - Icon free download
BsChevronBarExpand
chevron, bar, left, arrow-left, navigate-left, back, previous, slide-left, scroll-left, ui, menu, sidebar, panel - Bootstrap Icons - BsChevronBarLeft - SVG | WEBP | PNG | JPG - Icon free download
BsChevronBarLeft
chevron, bar, right, arrow-right, navigate-right, forward, next, slide-right, scroll-right, ui, panel, sidebar - Bootstrap Icons - BsChevronBarRight - SVG | WEBP | PNG | JPG - Icon free download
BsChevronBarRight
chevron, bar, up, arrow-up, navigate-up, scroll-up, expand-up, ui, menu, toggle, panel - Bootstrap Icons - BsChevronBarUp - SVG | WEBP | PNG | JPG - Icon free download
BsChevronBarUp
chevron, contract, collapse, shrink, reduce, close, arrow, nav, ui, toggle, panel, accordion - Bootstrap Icons - BsChevronContract - SVG | WEBP | PNG | JPG - Icon free download
BsChevronContract
chevron, expand, resize, arrow, full, maximize, toggle, layout, ui, button, panel, accordion, ios, android, web - Bootstrap Icons - BsChevronExpand - SVG | WEBP | PNG | JPG - Icon free download
BsChevronExpand
clipboard, pulse, clipboard-pulse, heartbeat, monitor, health, medical, vitals, record, chart, report, analytics, hospital, wellness, tracking, ui, dashboard - Bootstrap Icons - BsClipboardPulse - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardPulse
clipboard, data, clipboard-data, analytics, chart, stats, report, filled, document, sheet, form, tracking, metrics, business, monitor - Bootstrap Icons - BsClipboard2DataFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2DataFill
clipboard, clipboard2, pulse, heartbeat, vitals, monitor, health, medical, outline, patient, record, report, data, tracking, hospital, clinic, ui, form - Bootstrap Icons - BsClipboard2Pulse - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2Pulse
columns-gap, columns, gap, layout, grid, design, structure, ui, editor, builder, page-layout, web-design, template - Bootstrap Icons - BsColumnsGap - SVG | WEBP | PNG | JPG - Icon free download
BsColumnsGap
columns, layout, grid, structure, builder, editor, design, ui, template, page-structure - Bootstrap Icons - BsColumns - SVG | WEBP | PNG | JPG - Icon free download
BsColumns
command, cmd, command-key, shortcut, mac, keyboard, hotkey, key-symbol, apple, desktop, ui, modifier - Bootstrap Icons - BsCommand - SVG | WEBP | PNG | JPG - Icon free download
BsCommand
controller, gamepad, gaming, console, joystick, play, video-game, entertainment, device, esports, arcade, ui, button, menu, interaction - Bootstrap Icons - BsController - SVG | WEBP | PNG | JPG - Icon free download
BsController
cpu, processor, chip, hardware, computer, technology, filled, performance, system, server, core, electronics, monitoring, diagnostics, iot, device - Bootstrap Icons - BsCpuFill - SVG | WEBP | PNG | JPG - Icon free download
BsCpuFill
cpu, processor, chip, hardware, computer, technology, outline, system, performance, core, server, iot, diagnostics, device, monitoring - Bootstrap Icons - BsCpu - SVG | WEBP | PNG | JPG - Icon free download
BsCpu
device, hdd, hard-disk, drive, storage, hardware, backup, disk, file-system, local-storage, server, data, io, performance, tech, filled - Bootstrap Icons - BsDeviceHddFill - SVG | WEBP | PNG | JPG - Icon free download
BsDeviceHddFill
device, hdd, hard-disk, disk, drive, storage, local-storage, hardware, backup, server, io, tech, thin-line - Bootstrap Icons - BsDeviceHdd - SVG | WEBP | PNG | JPG - Icon free download
BsDeviceHdd
ssd, solid-state-drive, storage, device, drive, disk, hardware, performance, fast-storage, tech, filled, system, file-system, memory - Bootstrap Icons - BsDeviceSsdFill - SVG | WEBP | PNG | JPG - Icon free download
BsDeviceSsdFill
ssd, solid-state-drive, storage, hardware, device, drive, disk, performance, fast-storage, thin-line, settings, system, memory - Bootstrap Icons - BsDeviceSsd - SVG | WEBP | PNG | JPG - Icon free download
BsDeviceSsd
diagram, flowchart, structure, layout, nodes, connections, process, workflow, business, graph, chart, organization, mapping, visual, filled - Bootstrap Icons - BsDiagram2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsDiagram2Fill
diagram, flowchart, structure, layout, nodes, connections, workflow, process, mapping, thin-line, visual, organization - Bootstrap Icons - BsDiagram2 - SVG | WEBP | PNG | JPG - Icon free download
BsDiagram2
display, monitor, screen, desktop, pc, computer, filled, device, hardware, workstation, ui, presentation, preview, layout, dashboard, web, ios, android - Bootstrap Icons - BsDisplayFill - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayFill
display, monitor, screen, desktop, outline, pc, computer, device, hardware, workspace, dashboard, preview, ui, web, minimal, android, ios - Bootstrap Icons - BsDisplay - SVG | WEBP | PNG | JPG - Icon free download
BsDisplay
displayport, port, connector, filled, cable, video-output, monitor, screen, hardware, device, pc, laptop, input-output, tech, ui, web - Bootstrap Icons - BsDisplayportFill - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayportFill
displayport, port, connector, outline, video-output, monitor, hardware, pc, laptop, screen, device, tech, wire, cable, ui, web, ios, android - Bootstrap Icons - BsDisplayport - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayport
distribute, horizontal, alignment, layout, spacing, ui, editor, design, arrange, grid, visual, elements, toolbar, button, format, canvas, graphics, web, ios, android - Bootstrap Icons - BsDistributeHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsDistributeHorizontal
distribute, vertical, alignment, spacing, layout, editor, arrange, design, grid, visual, elements, toolbar, button, ui, graphics, canvas, web, android, ios - Bootstrap Icons - BsDistributeVertical - SVG | WEBP | PNG | JPG - Icon free download
BsDistributeVertical
earbuds, earphones, headphones, audio, music, sound, listen, media, device, portable-audio, wireless, wired, stereo, entertainment - Bootstrap Icons - BsEarbuds - SVG | WEBP | PNG | JPG - Icon free download
BsEarbuds
easel, art, painting, canvas, display, presentation, stand, filled, design, creative, drawing, board, artist-tool - Bootstrap Icons - BsEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsEaselFill
easel, canvas, stand, painting, art, outline, creative, design, drawing, presentation, artist-tool, display - Bootstrap Icons - BsEasel - SVG | WEBP | PNG | JPG - Icon free download
BsEasel
easel, easel2, art, canvas, painting, creative, filled, design, drawing, presentation, stand, board, artist - Bootstrap Icons - BsEasel2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsEasel2Fill
easel, easel2, art, canvas, outline, painting, drawing, creative, presentation, design, stand - Bootstrap Icons - BsEasel2 - SVG | WEBP | PNG | JPG - Icon free download
BsEasel2
easel3, easel, art, canvas, painting, drawing, creative, presentation, filled, design, stand, board - Bootstrap Icons - BsEasel3Fill - SVG | WEBP | PNG | JPG - Icon free download
BsEasel3Fill
easel3, easel, art, canvas, outline, painting, drawing, creative, presentation, stand, design - Bootstrap Icons - BsEasel3 - SVG | WEBP | PNG | JPG - Icon free download
BsEasel3
eject, eject-fill, media, control, player, audio, video, dvd, cd, remove, unmount, hardware, device, button, toolbar, ui, ios, android, web, playback, action, triangle, upward, system-control - Bootstrap Icons - BsEjectFill - SVG | WEBP | PNG | JPG - Icon free download
BsEjectFill
eject, media, control, line, outline, player, audio, video, remove, unmount, hardware, button, ui, toolbar, playback, triangle, system-control - Bootstrap Icons - BsEject - SVG | WEBP | PNG | JPG - Icon free download
BsEject
ethernet, network, lan, cable, connection, wired, router, internet, port, connectivity, hardware, outline, tech, iot - Bootstrap Icons - BsEthernet - SVG | WEBP | PNG | JPG - Icon free download
BsEthernet
eye, view, visible, see, show, preview, display, read, look, vision, toggle, ui, filled - Bootstrap Icons - BsEyeFill - SVG | WEBP | PNG | JPG - Icon free download
BsEyeFill
fan, cooling, air, wind, ventilation, climate, device, appliance, rotate, spin, outline - Bootstrap Icons - BsFan - SVG | WEBP | PNG | JPG - Icon free download
BsFan
file, break, divider, split, section, filled, document, page, sheet, edit, modify, layout, ui, structure - Bootstrap Icons - BsFileBreakFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileBreakFill
file, break, split, divider, section, outline, document, page, sheet, format, editing, ui, structure, layout - Bootstrap Icons - BsFileBreak - SVG | WEBP | PNG | JPG - Icon free download
BsFileBreak
file, earmark, easel, presentation, design, art, canvas, creative, education, teaching, filled - Bootstrap Icons - BsFileEarmarkEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkEaselFill
file, earmark, easel, presentation, design, art, canvas, creative, education, outline - Bootstrap Icons - BsFileEarmarkEasel - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkEasel
file, earmark, font, text, document, typography, writing, editor, layout, style, design, content, formatting, ui - Bootstrap Icons - BsFileEarmarkFontFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkFontFill
file, earmark, ppt, presentation, slides, powerpoint, office, business, deck, slide-file, meeting, lecture, training, visual, document - Bootstrap Icons - BsFileEarmarkPptFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPptFill
file, earmark, ppt, presentation, slides, powerpoint, slide-file, meeting, lecture, deck, outline, office, document - Bootstrap Icons - BsFileEarmarkPpt - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPpt
file, earmark, slides, presentation, deck, slide-file, ppt, multimedia, lecture, meeting, class, office, training, visual - Bootstrap Icons - BsFileEarmarkSlidesFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkSlidesFill
file, earmark, slides, presentation, slide-file, deck, ppt, office, lecture, meeting, outline, training - Bootstrap Icons - BsFileEarmarkSlides - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkSlides
file, easel, presentation, design, art, canvas, board, creative, draft, layout, mockup, teaching, training, visual, slide, template - Bootstrap Icons - BsFileEaselFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEaselFill
file, easel, presentation, canvas, board, art, design, creative, draft, visual, slide, teaching, training, template, mockup - Bootstrap Icons - BsFileEasel - SVG | WEBP | PNG | JPG - Icon free download
BsFileEasel
file, ppt, file-ppt, presentation, powerpoint, slide, deck, office-file, business, meeting, classroom, education, slides, attachment - Bootstrap Icons - BsFilePptFill - SVG | WEBP | PNG | JPG - Icon free download
BsFilePptFill
file, ppt, file-ppt, presentation, slides, deck, powerpoint, office, meeting, lecture, education, attachment - Bootstrap Icons - BsFilePpt - SVG | WEBP | PNG | JPG - Icon free download
BsFilePpt
file, ruled, lined, document, paper, notes, notebook, text, sheet, record, writing, template, layout, office-doc, school, study, page, outline-file, bootstrap - Bootstrap Icons - BsFileRuled - SVG | WEBP | PNG | JPG - Icon free download
BsFileRuled
file, slides, presentation, ppt, slideshow, deck, filled, document, office, education, projector, report, bootstrap, file-slides - Bootstrap Icons - BsFileSlidesFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileSlidesFill
file, slides, presentation, ppt, outline, slideshow, deck, educational, report, meeting, bootstrap, file-slides - Bootstrap Icons - BsFileSlides - SVG | WEBP | PNG | JPG - Icon free download
BsFileSlides
file, css, styles, stylesheet, frontend, design, theme, layout, web, ui, styling, syntax, code, developer, vs-code, project, build, assets, webpage, css-file - Bootstrap Icons - BsFiletypeCss - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeCss
file, html, markup, frontend, web, page, template, code, developer, syntax, editor, project, seo, layout, site, html-file - Bootstrap Icons - BsFiletypeHtml - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeHtml
file, key, keynote, presentation, slide, apple, mac, deck, talk, ppt, template, design, speaker, office, content, presentation-file - Bootstrap Icons - BsFiletypeKey - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeKey
file, otf, font, typeface, opentype, design, typography, style, assets, branding, text, editor, font-file, creative, layout - Bootstrap Icons - BsFiletypeOtf - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeOtf
file, ppt, filetype-ppt, presentation, slides, office, powerpoint, business, meeting, education, report, deck, attachment, download, upload, share, workspace, editor - Bootstrap Icons - BsFiletypePpt - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypePpt
file, pptx, filetype-pptx, presentation, slide-deck, office, powerpoint, business-report, meeting, education, training, download, upload, attachment, share, editor, workspace - Bootstrap Icons - BsFiletypePptx - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypePptx
file, psd, filetype-psd, photoshop, design, template, layer, editor, graphic, creative, asset, art, export, import, project-file, workspace, attachment, download - Bootstrap Icons - BsFiletypePsd - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypePsd
file, txt, filetype-txt, text, note, plain-text, editor, document, log, readme, config, data, attachment, download, simple-file, workspace, ui - Bootstrap Icons - BsFiletypeTxt - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeTxt
filter, left, alignment, refine, sort, options, criteria, sidebar, panel, ui, menu, button, list, filtering, organization, controls - Bootstrap Icons - BsFilterLeft - SVG | WEBP | PNG | JPG - Icon free download
BsFilterLeft
filter, right, refine, sort, criteria, sidebar, panel, alignment, options, controls, ui, menu, list, filtering - Bootstrap Icons - BsFilterRight - SVG | WEBP | PNG | JPG - Icon free download
BsFilterRight
filter, refine, funnel, sort, criteria, options, controls, ui, menu, button, list, search, panel, toggle - Bootstrap Icons - BsFilter - SVG | WEBP | PNG | JPG - Icon free download
BsFilter
fullscreen-exit, exit, fullscreen, shrink, collapse, screen, view, window, ui-control, media, video, player, layout, toolbar, button, interaction - Bootstrap Icons - BsFullscreenExit - SVG | WEBP | PNG | JPG - Icon free download
BsFullscreenExit
fullscreen, expand, open-fullscreen, screen, window, maximize, ui-control, media, player, layout, button, toolbar - Bootstrap Icons - BsFullscreen - SVG | WEBP | PNG | JPG - Icon free download
BsFullscreen
gpu, graphics-card, video-card, hardware, pci, gaming, render, compute, performance, pc-build, tech, device, workstation - Bootstrap Icons - BsGpuCard - SVG | WEBP | PNG | JPG - Icon free download
BsGpuCard
grid, 1x2, grid-fill, layout, columns, structure, dashboard, template, ui, split-view, panel, sidebar, widget - Bootstrap Icons - BsGrid1X2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsGrid1X2Fill
grid, 1x2, layout, split, columns, template, structure, panel, ui, dashboard, editor, arrangement - Bootstrap Icons - BsGrid1X2 - SVG | WEBP | PNG | JPG - Icon free download
BsGrid1X2
grid, 3x2, 3x2-grid, gap, filled, layout, interface, ui, matrix, tiles, blocks, dashboard, cards, sections, modules, widgets, apps, home-screen, menu-grid, navigation, button, select, arrange, structure, panel, responsive, web, mobile - Bootstrap Icons - BsGrid3X2GapFill - SVG | WEBP | PNG | JPG - Icon free download
BsGrid3X2GapFill
grid, 3x2, gap, outline, layout, ui, tiles, widgets, modules, sections, dashboard, launcher, app-grid, matrix, responsive, arrange, menu, structure, panel, mobile, web - Bootstrap Icons - BsGrid3X2Gap - SVG | WEBP | PNG | JPG - Icon free download
BsGrid3X2Gap
grid, 3x2, layout, outline, matrix, tiles, structure, blocks, widgets, panel, dashboard, ui, menu-grid, responsive, arrange - Bootstrap Icons - BsGrid3X2 - SVG | WEBP | PNG | JPG - Icon free download
BsGrid3X2
grid, 3x3, gap, filled, matrix, layout, tiles, blocks, ui, dashboard, app-grid, menu-grid, widgets, sections, responsive, structure, panel - Bootstrap Icons - BsGrid3X3GapFill - SVG | WEBP | PNG | JPG - Icon free download
BsGrid3X3GapFill
grid, 3x3, gap, outline, layout, ui, tiles, matrix, blocks, menu, sections, responsive, panel, widgets, launcher - Bootstrap Icons - BsGrid3X3Gap - SVG | WEBP | PNG | JPG - Icon free download
BsGrid3X3Gap
grid, 3x3, layout, matrix, outline, tiles, widgets, apps, modules, sections, panel, responsive, menu-grid, dashboard - Bootstrap Icons - BsGrid3X3 - SVG | WEBP | PNG | JPG - Icon free download
BsGrid3X3
grid, filled, layout, tiles, matrix, ui, dashboard, menu-grid, launcher, blocks, sections, structure, panel, responsive, modules - Bootstrap Icons - BsGridFill - SVG | WEBP | PNG | JPG - Icon free download
BsGridFill
grid, outline, layout, tiles, ui, structure, panel, matrix, dashboard, menu-grid, modules, responsive, apps - Bootstrap Icons - BsGrid - SVG | WEBP | PNG | JPG - Icon free download
BsGrid
hammer, tool, hardware, construction, build, repair, work, fix, diy, craft, strike, impact, maintenance, equipment, utility, workshop, action - Bootstrap Icons - BsHammer - SVG | WEBP | PNG | JPG - Icon free download
BsHammer
hdd, hard-drive, storage, disk, drive, filled, device, hardware, memory, backup, computer, server, data, capacity - Bootstrap Icons - BsHddFill - SVG | WEBP | PNG | JPG - Icon free download
BsHddFill
hdd, network, network-drive, nas, filled, storage, server, data, infrastructure, cloud, shared-drive, hardware, backup, device - Bootstrap Icons - BsHddNetworkFill - SVG | WEBP | PNG | JPG - Icon free download
BsHddNetworkFill
hdd, network, network-drive, nas, outline, storage, hardware, server, cloud, infrastructure, shared-drive, backup, data - Bootstrap Icons - BsHddNetwork - SVG | WEBP | PNG | JPG - Icon free download
BsHddNetwork
hdd, rack, server-rack, storage, datacenter, filled, infrastructure, server, hardware, stack, data, it - Bootstrap Icons - BsHddRackFill - SVG | WEBP | PNG | JPG - Icon free download
BsHddRackFill
hdd, rack, server-rack, outline, storage, hardware, data, infrastructure, datacenter, it, device - Bootstrap Icons - BsHddRack - SVG | WEBP | PNG | JPG - Icon free download
BsHddRack
hdd, stack, stacked-drives, filled, storage, data, hardware, server, capacity, layers, backup, it - Bootstrap Icons - BsHddStackFill - SVG | WEBP | PNG | JPG - Icon free download
BsHddStackFill
hdd, stack, storage, outline, multi-drive, hardware, server, backup, layers, capacity, it, infrastructure - Bootstrap Icons - BsHddStack - SVG | WEBP | PNG | JPG - Icon free download
BsHddStack
hdd, hard-drive, disk, storage, outline, device, hardware, computer, memory, data, backup, server - Bootstrap Icons - BsHdd - SVG | WEBP | PNG | JPG - Icon free download
BsHdd
hdmi, cable, port, display, connector, video, audio, filled, interface, tv, monitor, projector, hardware - Bootstrap Icons - BsHdmiFill - SVG | WEBP | PNG | JPG - Icon free download
BsHdmiFill
hdmi, cable, port, connector, outline, display, video, audio, tv, monitor, hardware, settings - Bootstrap Icons - BsHdmi - SVG | WEBP | PNG | JPG - Icon free download
BsHdmi
headphones, audio, music, sound, listen, earphones, device, outline, media, entertainment, volume, voice, podcast - Bootstrap Icons - BsHeadphones - SVG | WEBP | PNG | JPG - Icon free download
BsHeadphones
headset, vr, virtual-reality, gaming, immersive, 3d, device, outline, technology, entertainment, simulation - Bootstrap Icons - BsHeadsetVr - SVG | WEBP | PNG | JPG - Icon free download
BsHeadsetVr
heart, pulse, heartbeat, vitals, ecg, health, medical, monitor, fitness, wellness, filled, cardio, health-monitoring, tracker, diagnostics - Bootstrap Icons - BsHeartPulseFill - SVG | WEBP | PNG | JPG - Icon free download
BsHeartPulseFill
heptagon, 7-sides, polygon, shape, geometric, filled, layout, frame, border, design-element, symmetry - Bootstrap Icons - BsHeptagonFill - SVG | WEBP | PNG | JPG - Icon free download
BsHeptagonFill
heptagon, half, polygon, 7-sides, geometric, shape, partial, layout, frame, design-element - Bootstrap Icons - BsHeptagonHalf - SVG | WEBP | PNG | JPG - Icon free download
BsHeptagonHalf
heptagon, polygon, outline, 7-sides, geometric, shape, frame, border, design-element, symmetry - Bootstrap Icons - BsHeptagon - SVG | WEBP | PNG | JPG - Icon free download
BsHeptagon
hexagon, 6-sides, polygon, shape, geometric, filled, design-element, frame, layout, symmetry - Bootstrap Icons - BsHexagonFill - SVG | WEBP | PNG | JPG - Icon free download
BsHexagonFill
hexagon, half, polygon, 6-sides, shape, geometric, partial, design-element, layout, frame - Bootstrap Icons - BsHexagonHalf - SVG | WEBP | PNG | JPG - Icon free download
BsHexagonHalf
hexagon, polygon, outline, 6-sides, geometric, shape, frame, border, symmetry, design-element - Bootstrap Icons - BsHexagon - SVG | WEBP | PNG | JPG - Icon free download
BsHexagon
hr, horizontal-rule, divider, separator, line, break, layout, ui, content, formatting, web-design - Bootstrap Icons - BsHr - SVG | WEBP | PNG | JPG - Icon free download
BsHr
inboxes, inbox, mail, email, messages, folders, storage, archive, communication, workspace, dashboard, ui, sidebar, navigation, container, multiple-inbox, incoming, sorting, organization - Bootstrap Icons - BsInboxes - SVG | WEBP | PNG | JPG - Icon free download
BsInboxes
indent, text, layout, spacing, editor, alignment, formatting, document, paragraph, ui-control, toolbar, wysiwyg, content-editing - Bootstrap Icons - BsIndent - SVG | WEBP | PNG | JPG - Icon free download
BsIndent
intersect, intersection, overlap, shape, geometry, design, graphics, vector, path, ui, layout, combine, merge - Bootstrap Icons - BsIntersect - SVG | WEBP | PNG | JPG - Icon free download
BsIntersect
joystick, game, gaming, controller, console, arcade, play, input, device - Bootstrap Icons - BsJoystick - SVG | WEBP | PNG | JPG - Icon free download
BsJoystick
keyboard, typing, input, device, hardware, keys, filled - Bootstrap Icons - BsKeyboardFill - SVG | WEBP | PNG | JPG - Icon free download
BsKeyboardFill
keyboard, device, input, typing, keys, hardware, outline - Bootstrap Icons - BsKeyboard - SVG | WEBP | PNG | JPG - Icon free download
BsKeyboard
laptop, laptop-fill, notebook, computer, pc, device, workstation, macbook, portable, tech, hardware, remote-work, wfh, profile, dashboard, product-card, shop, icon-button - Bootstrap Icons - BsLaptopFill - SVG | WEBP | PNG | JPG - Icon free download
BsLaptopFill
laptop, notebook, computer, pc, device, portable, tech, hardware, work, remote-work, wfh, profile, dashboard, product, shop, button, ui-icon - Bootstrap Icons - BsLaptop - SVG | WEBP | PNG | JPG - Icon free download
BsLaptop
layers, layers-fill, stack, stacked, group, composition, overlays, map-layers, depth, grouping, multi-layer, editor, layout, panel, icon, badge - Bootstrap Icons - BsLayersFill - SVG | WEBP | PNG | JPG - Icon free download
BsLayersFill
layers, half, layers-half, partial, overlay, stack, stacked, group, composition, map-overlay, mixed, partial-fill, layer-state, editor, panel - Bootstrap Icons - BsLayersHalf - SVG | WEBP | PNG | JPG - Icon free download
BsLayersHalf
layers, stack, stacked, group, composition, overlays, map-layers, depth, grouping, multi-layer, editor, layout, panel, icon, arrange - Bootstrap Icons - BsLayers - SVG | WEBP | PNG | JPG - Icon free download
BsLayers
layout, sidebar, inset, reverse, layout-sidebar-inset-reverse, two-column, page-template, dashboard, admin, responsive, template, panel, navigation, content, grid - Bootstrap Icons - BsLayoutSidebarInsetReverse - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebarInsetReverse
layout, sidebar, inset, layout-sidebar-inset, two-column, page-template, dashboard, admin, responsive, template, panel, navigation, content, grid - Bootstrap Icons - BsLayoutSidebarInset - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebarInset
layout, sidebar, reverse, layout-sidebar-reverse, left-sidebar, right-sidebar, page-template, dashboard, admin, responsive, navigation, content, panel - Bootstrap Icons - BsLayoutSidebarReverse - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebarReverse
layout, sidebar, layout-sidebar, left-sidebar, right-sidebar, page-template, dashboard, admin, navigation, content, panel, responsive, template - Bootstrap Icons - BsLayoutSidebar - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebar
layout, split, layout-split, two-column, split-view, divider, panel, dashboard, admin, responsive, content, template, grid - Bootstrap Icons - BsLayoutSplit - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSplit
layout, text, sidebar, reverse, layout-text-sidebar-reverse, content-and-sidebar, article-layout, blog, responsive, template, admin, panel - Bootstrap Icons - BsLayoutTextSidebarReverse - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutTextSidebarReverse
layout, text, sidebar, layout-text-sidebar, content-and-sidebar, article-layout, blog, responsive, template, admin, panel, editor - Bootstrap Icons - BsLayoutTextSidebar - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutTextSidebar
layout, text, window, reverse, layout-text-window-reverse, content-window, panel, editor, responsive, template, admin, document - Bootstrap Icons - BsLayoutTextWindowReverse - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutTextWindowReverse
layout, text, window, layout-text-window, content-window, panel, editor, document, responsive, template, admin - Bootstrap Icons - BsLayoutTextWindow - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutTextWindow
layout, three-columns, 3-column, grid, layout-three-columns, multi-column, panel, dashboard, admin, responsive, template, content - Bootstrap Icons - BsLayoutThreeColumns - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutThreeColumns
layout, wtf, layout-wtf, unexpected, weird, placeholder, experimental, novelty, debug, developer-joke, icon-placeholder, unknown-layout, quirky, badge, marker - Bootstrap Icons - BsLayoutWtf - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutWtf
list, columns, reverse, layout, grid, table, arrangement, structure, organize, outline, ui, content - Bootstrap Icons - BsListColumnsReverse - SVG | WEBP | PNG | JPG - Icon free download
BsListColumnsReverse
list, columns, layout, table, grid, structure, content, organize, outline, ui - Bootstrap Icons - BsListColumns - SVG | WEBP | PNG | JPG - Icon free download
BsListColumns
list, ul, unordered-list, bullet-list, text, content, items, menu, navigation, structure, layout, document, notes, tasks, todo, outline, web, app, ui, sidebar, panel, markdown, rich-text - Bootstrap Icons - BsListUl - SVG | WEBP | PNG | JPG - Icon free download
BsListUl
list, menu, items, nav, navigation, text, content, outline, tasks, todo, notes, structure, layout, sidebar, ui, web, app, panel, table-of-contents - Bootstrap Icons - BsList - SVG | WEBP | PNG | JPG - Icon free download
BsList
memory, ram, chip, module, hardware, component, device, performance, tech, computer, motherboard, outline, system, upgrade, electronics, iot, server - Bootstrap Icons - BsMemory - SVG | WEBP | PNG | JPG - Icon free download
BsMemory
microsoft, teams, microsoft-teams, brand, logo, chat, collaboration, communication, video-call, meeting, workplace, office, enterprise, productivity, teamwork, group-chat, messaging, remote-work, desktop, webapp, button, navbar, sidebar - Bootstrap Icons - BsMicrosoftTeams - SVG | WEBP | PNG | JPG - Icon free download
BsMicrosoftTeams
microsoft, brand, logo, windows, office, tech, software, corporate, company, ms, brandmark, enterprise, desktop, ecosystem, productivity, technology-company, webapp, navbar, footer - Bootstrap Icons - BsMicrosoft - SVG | WEBP | PNG | JPG - Icon free download
BsMicrosoft
modem, filled, router, internet, network, wifi, device, connectivity, bandwidth, broadband, signal, lan, hardware, settings, tech, iot - Bootstrap Icons - BsModemFill - SVG | WEBP | PNG | JPG - Icon free download
BsModemFill
modem, router, network, wifi, internet, connectivity, hardware, device, lan, broadband, signal, settings, iot, tech - Bootstrap Icons - BsModem - SVG | WEBP | PNG | JPG - Icon free download
BsModem
motherboard, circuit, filled, hardware, chip, electronics, computer, tech, device, board, processor, system, engineer, iot, components - Bootstrap Icons - BsMotherboardFill - SVG | WEBP | PNG | JPG - Icon free download
BsMotherboardFill
motherboard, circuit, outline, hardware, electronics, chip, processor, computer, tech, device, board, components, engineering, iot - Bootstrap Icons - BsMotherboard - SVG | WEBP | PNG | JPG - Icon free download
BsMotherboard
mouse, filled, pointer, input, device, computer, hardware, click, cursor, navigation, desktop, peripheral, interaction, ui - Bootstrap Icons - BsMouseFill - SVG | WEBP | PNG | JPG - Icon free download
BsMouseFill
mouse, outline, pointer, cursor, input, device, computer, hardware, click, peripheral, desktop, navigation - Bootstrap Icons - BsMouse - SVG | WEBP | PNG | JPG - Icon free download
BsMouse
mouse2, filled, mouse, input, device, hardware, computer, pointer, cursor, peripheral, gaming, click, navigation - Bootstrap Icons - BsMouse2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsMouse2Fill
mouse2, outline, mouse, input, device, hardware, computer, pointer, cursor, navigation, peripheral, tech, gaming - Bootstrap Icons - BsMouse2 - SVG | WEBP | PNG | JPG - Icon free download
BsMouse2
mouse3, filled, mouse, input, device, hardware, cursor, pointer, navigation, peripheral, computer, gaming, tech - Bootstrap Icons - BsMouse3Fill - SVG | WEBP | PNG | JPG - Icon free download
BsMouse3Fill
mouse, computer-mouse, pointer, cursor-device, input-device, hardware, usb, bluetooth, click, scroll, device, peripheral, desktop, laptop, mac, windows, linux, workstation, productivity, office, navigation, ui-control - Bootstrap Icons - BsMouse3 - SVG | WEBP | PNG | JPG - Icon free download
BsMouse3
music-player, player, audio-player, media-player, filled, sound, track, song, device, music-ui, controls, playback, playlist - Bootstrap Icons - BsMusicPlayerFill - SVG | WEBP | PNG | JPG - Icon free download
BsMusicPlayerFill
nut, bolt-nut, hardware, fastener, construction, mechanical, tools, engineering, filled, assembly, industrial - Bootstrap Icons - BsNutFill - SVG | WEBP | PNG | JPG - Icon free download
BsNutFill
nut, hardware, fastener, bolt-nut, mechanical, construction, tools, engineering, metal, industrial - Bootstrap Icons - BsNut - SVG | WEBP | PNG | JPG - Icon free download
BsNut
nvidia, brand, gpu, graphics-card, rtx, geforce, hardware, ai, machine-learning, computing, tech - Bootstrap Icons - BsNvidia - SVG | WEBP | PNG | JPG - Icon free download
BsNvidia
nvme, ssd, storage, drive, fast-storage, m2, hardware, device, disk, flash-storage, filled, pc-component - Bootstrap Icons - BsNvmeFill - SVG | WEBP | PNG | JPG - Icon free download
BsNvmeFill
nvme, ssd, storage, drive, solid-state, fast-storage, hardware, component, pc, tech, disk - Bootstrap Icons - BsNvme - SVG | WEBP | PNG | JPG - Icon free download
BsNvme
octagon, shape, eight-sided, polygon, geometry, frame, border, container, stop-shape, warning, highlight, ui-shape, outline, badge, symbol - Bootstrap Icons - BsOctagon - SVG | WEBP | PNG | JPG - Icon free download
BsOctagon
outlet, power-outlet, socket, plug, electricity, wall-socket, charging, power, voltage, connector, home, hardware, outline - Bootstrap Icons - BsOutlet - SVG | WEBP | PNG | JPG - Icon free download
BsOutlet
pc, display, horizontal, monitor, screen, desktop, computer, hardware, ui, workspace, device - Bootstrap Icons - BsPcDisplayHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsPcDisplayHorizontal
pc, display, monitor, desktop, screen, computer, hardware, device, ui, workspace - Bootstrap Icons - BsPcDisplay - SVG | WEBP | PNG | JPG - Icon free download
BsPcDisplay
pc, horizontal, screen, monitor, computer, desktop, device, hardware, ui - Bootstrap Icons - BsPcHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsPcHorizontal
pc, computer, desktop, workstation, monitor, device, hardware, screen, setup, tech, ui, dashboard, sidebar, toolbar, windows, linux, mac, developer, coding, work - Bootstrap Icons - BsPc - SVG | WEBP | PNG | JPG - Icon free download
BsPc
pci, card, network, pci-card, network-card, adapter, ethernet, lan, hardware, device, chip, module, server, router, nic, bandwidth, connect, system, tech - Bootstrap Icons - BsPciCardNetwork - SVG | WEBP | PNG | JPG - Icon free download
BsPciCardNetwork
pci, card, sound, audio-card, sound-card, hardware, audio, speaker, multimedia, chip, module, device, system, music, media, tech, pc - Bootstrap Icons - BsPciCardSound - SVG | WEBP | PNG | JPG - Icon free download
BsPciCardSound
pci, card, expansion-card, hardware, chip, module, pc, device, system, tech, slot, component, board, electronics - Bootstrap Icons - BsPciCard - SVG | WEBP | PNG | JPG - Icon free download
BsPciCard
pentagon, shape, geometry, filled, polygon, badge, mark, icon, design, layout, ui, block, container - Bootstrap Icons - BsPentagonFill - SVG | WEBP | PNG | JPG - Icon free download
BsPentagonFill
people, users, group, community, team, filled, crowd, members, friends, social, avatar, profile, ui, panel, contacts - Bootstrap Icons - BsPeopleFill - SVG | WEBP | PNG | JPG - Icon free download
BsPeopleFill
person, bounding-box, crop, frame, user, avatar, profile, focus, selection, highlight, ui, container - Bootstrap Icons - BsPersonBoundingBox - SVG | WEBP | PNG | JPG - Icon free download
BsPersonBoundingBox
person, gear, user, profile, account, settings, preferences, configure, manage, tools, options, controls, system, admin, avatar, headshot, outline, bootstrap, ui, header, sidebar, menu, panel, actions - Bootstrap Icons - BsPersonGear - SVG | WEBP | PNG | JPG - Icon free download
BsPersonGear
person, workspace, user, work, office, desk, employee, staff, team, avatar, profile, business, corporate, tasks, job, workplace, dashboard, ui, menu, sidebar - Bootstrap Icons - BsPersonWorkspace - SVG | WEBP | PNG | JPG - Icon free download
BsPersonWorkspace
phone, mobile, call, device, smartphone, communication, dial, telephone, contact, cell, handset, telecom, ui, menu, sidebar, button - Bootstrap Icons - BsPhoneFill - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneFill
phone, flip, rotate, orientation, mobile, device, smartphone, call, contact, communication, rotate-phone, screen, ui, gesture, interaction - Bootstrap Icons - BsPhoneFlip - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneFlip
phone, landscape, rotate, mobile, smartphone, horizontal, orientation, media-view, full-screen, device, call, ui, layout, responsive - Bootstrap Icons - BsPhoneLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneLandscapeFill
phone, landscape, horizontal, rotate, mobile, device, smartphone, responsive, call, screen, ui, layout, orientation - Bootstrap Icons - BsPhoneLandscape - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneLandscape
phone, vibrate, mobile, alert, notification, silent, device, buzz, smartphone, contact, call, ringer, ui, settings, mode - Bootstrap Icons - BsPhoneVibrateFill - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneVibrateFill
phone, vibrate, mobile, silent, alert, notification, buzz, ringer, device, smartphone, contact, ui, settings, toggle - Bootstrap Icons - BsPhoneVibrate - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneVibrate
phone, mobile, call, device, smartphone, telephone, contact, dial, communication, cellphone, ui, menu, sidebar, icon - Bootstrap Icons - BsPhone - SVG | WEBP | PNG | JPG - Icon free download
BsPhone
pie, chart, pie-chart, data, analytics, visual, graph, report, statistics, dashboard, metrics, segments, ui, widget, presentation - Bootstrap Icons - BsPieChart - SVG | WEBP | PNG | JPG - Icon free download
BsPieChart
pip, picture-in-picture, mini-player, video, window, overlay, media, popout, playback, streaming, tv, multimedia, ui, button, player - Bootstrap Icons - BsPipFill - SVG | WEBP | PNG | JPG - Icon free download
BsPipFill
pip, picture-in-picture, mini-player, video, player, overlay, popout, streaming, tv, media, ui, control, toolbar - Bootstrap Icons - BsPip - SVG | WEBP | PNG | JPG - Icon free download
BsPip
plug, power, electric, connector, socket, charge, cable, energy, adapter, electricity, hardware, device, plug-fill - Bootstrap Icons - BsPlugFill - SVG | WEBP | PNG | JPG - Icon free download
BsPlugFill
plug, power, electric, connector, electricity, socket, adapter, cable, charger, device, hardware, utility - Bootstrap Icons - BsPlug - SVG | WEBP | PNG | JPG - Icon free download
BsPlug
power, on, off, switch, toggle, device, system, control - Bootstrap Icons - BsPower - SVG | WEBP | PNG | JPG - Icon free download
BsPower
printer, print, device, hardware, filled, office, copy, document - Bootstrap Icons - BsPrinterFill - SVG | WEBP | PNG | JPG - Icon free download
BsPrinterFill
printer, print, hardware, office, outline, copy, document - Bootstrap Icons - BsPrinter - SVG | WEBP | PNG | JPG - Icon free download
BsPrinter
projector, presentation, display, filled, media, screen, office - Bootstrap Icons - BsProjectorFill - SVG | WEBP | PNG | JPG - Icon free download
BsProjectorFill
projector, presentation, display, outline, meeting, screen, media - Bootstrap Icons - BsProjector - SVG | WEBP | PNG | JPG - Icon free download
BsProjector
qr, qr-code, scan, scanner, barcode, camera, payment, ticket, verify, authentication, access, checkout, mobile, square-code, reader, scan-mode, capture, outline, device, utility, shop, coupon - Bootstrap Icons - BsQrCodeScan - SVG | WEBP | PNG | JPG - Icon free download
BsQrCodeScan
radar, scan, signal, detect, tracking, range, circle, waves, sensor, iot, motion, search, locate, find, outline, device - Bootstrap Icons - BsRadar - SVG | WEBP | PNG | JPG - Icon free download
BsRadar
reception, signal, zero-signal, connectivity, network, bars, weak, offline, no-signal, status, indicator, device, wireless - Bootstrap Icons - BsReception0 - SVG | WEBP | PNG | JPG - Icon free download
BsReception0
reception, signal, one-bar, weak, low-signal, connectivity, network, wireless, status, indicator, mobile, device - Bootstrap Icons - BsReception1 - SVG | WEBP | PNG | JPG - Icon free download
BsReception1
reception, signal, two-bars, medium-signal, connectivity, network, wireless, status, indicator, mobile, device - Bootstrap Icons - BsReception2 - SVG | WEBP | PNG | JPG - Icon free download
BsReception2
reception, signal, three-bars, good-signal, connectivity, network, wireless, status, indicator, device, mobile - Bootstrap Icons - BsReception3 - SVG | WEBP | PNG | JPG - Icon free download
BsReception3
robot, bot, ai, automation, machine, android, tech, technology, robotics, assistant, chatbot, automation, iot, device, gadget, toy, avatar, character, automation-ui - Bootstrap Icons - BsRobot - SVG | WEBP | PNG | JPG - Icon free download
BsRobot
router, wifi, network, internet, modem, signal, connectivity, device, hardware, filled, iot, lan, wan, home-network, office-network, tech, settings - Bootstrap Icons - BsRouterFill - SVG | WEBP | PNG | JPG - Icon free download
BsRouterFill
router, wifi, network, internet, device, signal, modem, outline, hardware, iot, lan, wan, connectivity, tech, settings - Bootstrap Icons - BsRouter - SVG | WEBP | PNG | JPG - Icon free download
BsRouter
ruler, rulers, measure, measurement, length, design, layout, spacing, drafting, tool, ui-design, grid, craft, alignment, editor, workspace - Bootstrap Icons - BsRulers - SVG | WEBP | PNG | JPG - Icon free download
BsRulers
screwdriver, tool, fix, repair, maintenance, hardware, construction, build, adjust, tighten - Bootstrap Icons - BsScrewdriver - SVG | WEBP | PNG | JPG - Icon free download
BsScrewdriver
sd, sd-card, memory, flash, storage, filled, device, media, camera, recording, backup - Bootstrap Icons - BsSdCardFill - SVG | WEBP | PNG | JPG - Icon free download
BsSdCardFill
sd, sd-card, memory, outline, storage, flash, device, camera, media, removable - Bootstrap Icons - BsSdCard - SVG | WEBP | PNG | JPG - Icon free download
BsSdCard
segmented, nav, navigation, tabs, menu, switcher, toggle, ui-element, layout, control, toolbar - Bootstrap Icons - BsSegmentedNav - SVG | WEBP | PNG | JPG - Icon free download
BsSegmentedNav
server, hosting, backend, database, api, cloud, infrastructure, rack, hardware, storage, compute, network, devops, deployment, sysadmin, bootstrap, line-icon - Bootstrap Icons - BsServer - SVG | WEBP | PNG | JPG - Icon free download
BsServer
shop, window, shop-window, storefront, display-window, retail, store, shopfront, retail-sign, glass-window, store-display, ecommerce, shopping, product-display, header-icon, store-landing, cta, button, menu, sidebar, commerce - Bootstrap Icons - BsShopWindow - SVG | WEBP | PNG | JPG - Icon free download
BsShopWindow
sim, sim-card, mobile, cellular, network, chip, card, telecom, device, hardware, connectivity, carrier, filled, slot - Bootstrap Icons - BsSimFill - SVG | WEBP | PNG | JPG - Icon free download
BsSimFill
sim, sim-card, slash, no-sim, disabled, mobile, cellular, network, connectivity, hardware, carrier, warning, filled, blocked - Bootstrap Icons - BsSimSlashFill - SVG | WEBP | PNG | JPG - Icon free download
BsSimSlashFill
sim, sim-card, slash, no-sim, disabled, network, mobile, connectivity, hardware, warning, blocked, line - Bootstrap Icons - BsSimSlash - SVG | WEBP | PNG | JPG - Icon free download
BsSimSlash
sim, sim-card, cellular, mobile, network, chip, telecom, device, hardware, carrier, connectivity, line - Bootstrap Icons - BsSim - SVG | WEBP | PNG | JPG - Icon free download
BsSim
slack, brand, logo, team, workspace, communication, collaboration, chat, messaging, channels, work, office, productivity, online, platform, brand-icon, remote-work, team-chat, business-tool - Bootstrap Icons - BsSlack - SVG | WEBP | PNG | JPG - Icon free download
BsSlack
sliders, controls, settings, adjust, mix, fader, equalizer, preferences, audio, volume, tweak, panel, filter, ui, toolbar, button, sidebar, dashboard, outline, bootstrap, icon - Bootstrap Icons - BsSliders - SVG | WEBP | PNG | JPG - Icon free download
BsSliders
sliders, vertical, controls, settings, adjust, tweak, fader, equalizer, preferences, mixer, filters, ui, dashboard, panel, sidebar, outline, bootstrap, icon - Bootstrap Icons - BsSliders2Vertical - SVG | WEBP | PNG | JPG - Icon free download
BsSliders2Vertical
sliders, controls, settings, adjust, fader, equalizer, preferences, mixer, filters, ui, dashboard, panel, sidebar, outline, bootstrap, icon - Bootstrap Icons - BsSliders2 - SVG | WEBP | PNG | JPG - Icon free download
BsSliders2
smartwatch, watch, wearable, wearables, fitness, health, time, timer, device, iot, notifications, wearable-device, product-card, ecommerce, ui, outline, bootstrap, icon - Bootstrap Icons - BsSmartwatch - SVG | WEBP | PNG | JPG - Icon free download
BsSmartwatch
speaker, sound, audio, volume, loud, device, speaker-filled, music, media, playlist, ui, button, toggle, sound-on, output - Bootstrap Icons - BsSpeakerFill - SVG | WEBP | PNG | JPG - Icon free download
BsSpeakerFill
speaker, sound, audio, volume, device, music, media, sound-icon, ui, mute-toggle, output, playlist - Bootstrap Icons - BsSpeaker - SVG | WEBP | PNG | JPG - Icon free download
BsSpeaker
speedometer, gauge, meter, speed, performance, dashboard, indicator, monitor, stats, analytics, needle, ui, measurement - Bootstrap Icons - BsSpeedometer - SVG | WEBP | PNG | JPG - Icon free download
BsSpeedometer
speedometer, gauge, meter, speed, performance, monitor, dash, indicator, needle, stats, ui, analytics, measurement, variant - Bootstrap Icons - BsSpeedometer2 - SVG | WEBP | PNG | JPG - Icon free download
BsSpeedometer2
square, filled, shape, block, tile, ui, button, indicator, layout, container, geometry, solid-square - Bootstrap Icons - BsSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsSquareFill
square, half, shape, geometry, tile, contrast, brightness, ui, button, indicator, layout, container - Bootstrap Icons - BsSquareHalf - SVG | WEBP | PNG | JPG - Icon free download
BsSquareHalf
square, outline, shape, tile, geometry, box, ui, button, placeholder, layout, container, frame - Bootstrap Icons - BsSquare - SVG | WEBP | PNG | JPG - Icon free download
BsSquare
steam, brand, gaming, valve, platform, game-platform, pc-games, launcher, store, game-store, community, profile, badge, logo, brand-logo, games, multiplayer, pc, desktop, client - Bootstrap Icons - BsSteam - SVG | WEBP | PNG | JPG - Icon free download
BsSteam
sunset, sun, evening, dusk, horizon, sky, weather, nature, scenery, landscape, time, end-of-day, ui-icon, header, footer, background, illustration - Bootstrap Icons - BsSunsetFill - SVG | WEBP | PNG | JPG - Icon free download
BsSunsetFill
sunset, sun, dusk, evening, weather, sky, nature, outline-sun, horizon, scenery, landscape, time-indicator, ui-icon - Bootstrap Icons - BsSunset - SVG | WEBP | PNG | JPG - Icon free download
BsSunset
symmetry, horizontal, mirror, flip, design, layout, editor, align, graphics, ui-tool, transform - Bootstrap Icons - BsSymmetryHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsSymmetryHorizontal
symmetry, vertical, mirror, flip, design, editor, layout, align, graphics, transform, ui-tool - Bootstrap Icons - BsSymmetryVertical - SVG | WEBP | PNG | JPG - Icon free download
BsSymmetryVertical
table, grid, data, cells, rows, columns, spreadsheet, layout, ui, editor, database, structure - Bootstrap Icons - BsTable - SVG | WEBP | PNG | JPG - Icon free download
BsTable
tablet, device, mobile, screen, touch, app, ui, hardware, electronics, filled-device - Bootstrap Icons - BsTabletFill - SVG | WEBP | PNG | JPG - Icon free download
BsTabletFill
tablet, landscape, device, orientation, mobile, screen, touch, ui, hardware, filled-device - Bootstrap Icons - BsTabletLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsTabletLandscapeFill
tablet, landscape, orientation, device, mobile, ui, screen, outline-device - Bootstrap Icons - BsTabletLandscape - SVG | WEBP | PNG | JPG - Icon free download
BsTabletLandscape
tablet, device, screen, mobile, touch, electronics, ui, outline - Bootstrap Icons - BsTablet - SVG | WEBP | PNG | JPG - Icon free download
BsTablet
terminal, split, pane, window, cli, shell, console, multi-pane, developer, coding, split-view, layout, outline, productivity - Bootstrap Icons - BsTerminalSplit - SVG | WEBP | PNG | JPG - Icon free download
BsTerminalSplit
text, center, alignment, typography, format, editor, layout, paragraph, style, ui, button, toolbar, document, outline - Bootstrap Icons - BsTextCenter - SVG | WEBP | PNG | JPG - Icon free download
BsTextCenter
text, indent, left, indent-left, typography, format, editor, paragraph, layout, style, ui, toolbar, outline - Bootstrap Icons - BsTextIndentLeft - SVG | WEBP | PNG | JPG - Icon free download
BsTextIndentLeft
text, indent, indent-right, format, align, paragraph, spacing, editor, rich-text, document, layout, ui, toolbar, button, writing, content, toggle, navigation, sidebar, shift, move, arrow, ios, android, web - Bootstrap Icons - BsTextIndentRight - SVG | WEBP | PNG | JPG - Icon free download
BsTextIndentRight
text, left, text-left, align-left, alignment, paragraph, editor, format, writing, document, ui, toolbar, content, layout, button, typography, ios, android, web - Bootstrap Icons - BsTextLeft - SVG | WEBP | PNG | JPG - Icon free download
BsTextLeft
text, paragraph, format, writing, editor, rich-text, content, document, ui, toolbar, typography, block, layout, section, ios, android, web - Bootstrap Icons - BsTextParagraph - SVG | WEBP | PNG | JPG - Icon free download
BsTextParagraph
text, right, text-right, align-right, alignment, format, editor, document, writing, typography, ui, layout, toolbar, button, content, ios, android, web - Bootstrap Icons - BsTextRight - SVG | WEBP | PNG | JPG - Icon free download
BsTextRight
text, wrap, text-wrap, line-wrap, wrapping, format, paragraph, editor, typography, document, content, layout, ui, button, toggle, ios, android, web - Bootstrap Icons - BsTextWrap - SVG | WEBP | PNG | JPG - Icon free download
BsTextWrap
textarea, resize, resize-handle, expand, shrink, input-field, form, text, editor, typing, ui, interaction, drag, corner, layout, ios, android, web - Bootstrap Icons - BsTextareaResize - SVG | WEBP | PNG | JPG - Icon free download
BsTextareaResize
textarea, t, text, input, field, form, typing, editor, ui, layout, content, writing, box, ios, android, web - Bootstrap Icons - BsTextareaT - SVG | WEBP | PNG | JPG - Icon free download
BsTextareaT
textarea, input, text-field, form, typing, editor, content, write, ui, box, layout, ios, android, web - Bootstrap Icons - BsTextarea - SVG | WEBP | PNG | JPG - Icon free download
BsTextarea
thermometer, half, temperature, medium, heat, cool, sensor, climate, weather, health, fever, measurement, device, monitor, environment, temperature-reading, ios, android - Bootstrap Icons - BsThermometerHalf - SVG | WEBP | PNG | JPG - Icon free download
BsThermometerHalf
thermometer, high, temperature, hot, heat, warning, sensor, climate, weather, health, fever, environment, monitor, reading, alert, ios, android - Bootstrap Icons - BsThermometerHigh - SVG | WEBP | PNG | JPG - Icon free download
BsThermometerHigh
thermometer, low, temperature, cold, cool, freeze, sensor, climate, weather, monitor, reading, environment, alert, ios, android - Bootstrap Icons - BsThermometerLow - SVG | WEBP | PNG | JPG - Icon free download
BsThermometerLow
thermometer, temperature, sensor, measurement, climate, weather, reading, monitor, environment, health, fever, tool, device, ios, android - Bootstrap Icons - BsThermometer - SVG | WEBP | PNG | JPG - Icon free download
BsThermometer
tools, wrench, hammer, settings, repair, maintenance, fix, configure, development, hardware, toolkit, utilities, preferences, ui-settings - Bootstrap Icons - BsTools - SVG | WEBP | PNG | JPG - Icon free download
BsTools
tree, nature, forest, plant, eco, green, environment, landscape - Bootstrap Icons - BsTreeFill - SVG | WEBP | PNG | JPG - Icon free download
BsTreeFill
tv, television, screen, display, monitor, media, video, movie, streaming, entertainment, device, electronics, filled, dashboard-widget - Bootstrap Icons - BsTvFill - SVG | WEBP | PNG | JPG - Icon free download
BsTvFill
tv, television, screen, display, monitor, media, video, movie, streaming, entertainment, device, electronics, outline - Bootstrap Icons - BsTv - SVG | WEBP | PNG | JPG - Icon free download
BsTv
ui, checks, grid, ui-checks-grid, checkbox, multiple, selection, tick, options, form, list, layout, grid-view, dashboard, preferences, settings, filter, panel, widget - Bootstrap Icons - BsUiChecksGrid - SVG | WEBP | PNG | JPG - Icon free download
BsUiChecksGrid
ui, radios, grid, ui-radios-grid, radio-buttons, selection, choose, form, options, layout, grid-view, dashboard, widget - Bootstrap Icons - BsUiRadiosGrid - SVG | WEBP | PNG | JPG - Icon free download
BsUiRadiosGrid
unindent, text, editor, layout, format, paragraph, alignment, outdent, indentation, toolbar, document, writer, content - Bootstrap Icons - BsUnindent - SVG | WEBP | PNG | JPG - Icon free download
BsUnindent
union, shape, boolean, merge, combine, geometry, design, vector, path, graphics, tool, layout - Bootstrap Icons - BsUnion - SVG | WEBP | PNG | JPG - Icon free download
BsUnion
usb, usb-c, type-c, connector, port, hardware, device, cable, power, charging, fill - Bootstrap Icons - BsUsbCFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbCFill
usb, usb-c, type-c, connector, port, hardware, device, charging, data, cable - Bootstrap Icons - BsUsbC - SVG | WEBP | PNG | JPG - Icon free download
BsUsbC
usb, drive, usb-drive, fill, flash-drive, storage, backup, portable, memory, data, hardware - Bootstrap Icons - BsUsbDriveFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbDriveFill
usb, drive, usb-drive, flash-drive, storage, backup, portable, data, memory, hardware - Bootstrap Icons - BsUsbDrive - SVG | WEBP | PNG | JPG - Icon free download
BsUsbDrive
usb, usb-fill, connector, plug, port, hardware, device, tech, data-transfer, charging, cable, peripheral, io, connection, usb-symbol, desktop, laptop, ios, android, interface, sidebar, toolbar, settings, system - Bootstrap Icons - BsUsbFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbFill
usb, micro-usb, usb-micro, connector, mobile-port, charging, data-transfer, device, cable, plug, hardware, io, android, sidebar, toolbar, settings, phone-accessory, tech - Bootstrap Icons - BsUsbMicroFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbMicroFill
usb, micro-usb, usb-micro, connector, charging, data-transfer, mobile, android, cable, hardware, io, outline, tech, device-port, settings, system - Bootstrap Icons - BsUsbMicro - SVG | WEBP | PNG | JPG - Icon free download
BsUsbMicro
usb, mini-usb, usb-mini, connector, legacy-port, hardware, data-transfer, charging, cable, device, tech, io, plug, sidebar, settings - Bootstrap Icons - BsUsbMiniFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbMiniFill
usb, mini-usb, usb-mini, connector, charging, data-transfer, legacy-device, tech, hardware, cable, io, outline, settings, system - Bootstrap Icons - BsUsbMini - SVG | WEBP | PNG | JPG - Icon free download
BsUsbMini
usb, usb-plug, connector, plug, port, cable, charging, data, hardware, device, tech, io, filled, settings, connection, accessory - Bootstrap Icons - BsUsbPlugFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbPlugFill
usb, usb-plug, connector, plug, port, cable, data-transfer, charging, hardware, device, outline, io, settings, system - Bootstrap Icons - BsUsbPlug - SVG | WEBP | PNG | JPG - Icon free download
BsUsbPlug
usb, usb-symbol, universal-serial-bus, icon, symbol, tech, hardware, connector, data-transfer, charging, standard, logo, outline, settings, system - Bootstrap Icons - BsUsbSymbol - SVG | WEBP | PNG | JPG - Icon free download
BsUsbSymbol
usb, connector, port, data-transfer, charging, tech, hardware, io, outline, device, settings, cable, usb-port - Bootstrap Icons - BsUsb - SVG | WEBP | PNG | JPG - Icon free download
BsUsb
view, list, view-list, items, rows, menu, layout, navigation, organize, display, ui, sidebar, toolbar, outline, table, content - Bootstrap Icons - BsViewList - SVG | WEBP | PNG | JPG - Icon free download
BsViewList
view, stacked, view-stacked, layers, cards, tiles, layout, ui, stack, column, organize, content, outline, navigation, dashboard - Bootstrap Icons - BsViewStacked - SVG | WEBP | PNG | JPG - Icon free download
BsViewStacked
vr, virtual-reality, headset, immersive, 3d, gaming, device, tech, simulation, ar, ui - Bootstrap Icons - BsVr - SVG | WEBP | PNG | JPG - Icon free download
BsVr
watch, clock, time, device, wearable, smartwatch, timer, ui, settings - Bootstrap Icons - BsWatch - SVG | WEBP | PNG | JPG - Icon free download
BsWatch
webcam, camera, video, record, stream, meeting, call, device, conference, ui - Bootstrap Icons - BsWebcamFill - SVG | WEBP | PNG | JPG - Icon free download
BsWebcamFill
webcam, camera, video, device, stream, record, meeting, conference, ui - Bootstrap Icons - BsWebcam - SVG | WEBP | PNG | JPG - Icon free download
BsWebcam
window, dash, minimize, remove, ui-window, layout, panel, container, desktop, app-window, system-ui - Bootstrap Icons - BsWindowDash - SVG | WEBP | PNG | JPG - Icon free download
BsWindowDash
desktop, window, computer, monitor, ui-window, screen, os, system, app-window, layout - Bootstrap Icons - BsWindowDesktop - SVG | WEBP | PNG | JPG - Icon free download
BsWindowDesktop
window, dock, sidebar, panel, layout, ui-window, system, desktop, app-window, container - Bootstrap Icons - BsWindowDock - SVG | WEBP | PNG | JPG - Icon free download
BsWindowDock
fullscreen, expand, window, maximize, screen, ui-window, layout, display, view-mode, system - Bootstrap Icons - BsWindowFullscreen - SVG | WEBP | PNG | JPG - Icon free download
BsWindowFullscreen
window, plus, add, new-window, create, app-window, ui-window, desktop, system, panel - Bootstrap Icons - BsWindowPlus - SVG | WEBP | PNG | JPG - Icon free download
BsWindowPlus
window, sidebar, panel, navigation, layout, ui-window, menu, desktop, container, sections - Bootstrap Icons - BsWindowSidebar - SVG | WEBP | PNG | JPG - Icon free download
BsWindowSidebar
window, split, split-view, panel, layout, dual-view, ui-window, desktop, sections, container - Bootstrap Icons - BsWindowSplit - SVG | WEBP | PNG | JPG - Icon free download
BsWindowSplit
window, stack, layers, multiple-windows, tabs, panels, ui-window, desktop, container, workflow - Bootstrap Icons - BsWindowStack - SVG | WEBP | PNG | JPG - Icon free download
BsWindowStack
window, close, x, delete, exit, remove, ui-window, desktop, panel, action - Bootstrap Icons - BsWindowX - SVG | WEBP | PNG | JPG - Icon free download
BsWindowX
window, ui-window, panel, screen, layout, desktop, app-window, system, container, software - Bootstrap Icons - BsWindow - SVG | WEBP | PNG | JPG - Icon free download
BsWindow
windows, microsoft, os, brand, desktop, system, logo, software, pc, computer - Bootstrap Icons - BsWindows - SVG | WEBP | PNG | JPG - Icon free download
BsWindows
wrench, adjustable, tool, repair, settings, mechanic, maintenance, fix, gear, circle, filled, hardware - Bootstrap Icons - BsWrenchAdjustableCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsWrenchAdjustableCircleFill
wrench, adjustable, tool, repair, settings, mechanic, maintenance, fix, gear, circle, outline, hardware - Bootstrap Icons - BsWrenchAdjustableCircle - SVG | WEBP | PNG | JPG - Icon free download
BsWrenchAdjustableCircle
wrench, adjustable, tool, repair, mechanic, settings, maintenance, fix, hardware, equipment - Bootstrap Icons - BsWrenchAdjustable - SVG | WEBP | PNG | JPG - Icon free download
BsWrenchAdjustable
wrench, tool, settings, adjust, fix, repair, maintenance, configure, preferences, hardware, devtools, system-tool, setup, sidebar-action, toolbar - Bootstrap Icons - BsWrench - SVG | WEBP | PNG | JPG - Icon free download
BsWrench
align, align-bottom, layout, editor, design, position, justify-bottom, vertical-align, toolbar, ui, formatting, alignment - css.gg Icons - CgAlignBottom - SVG | WEBP | PNG | JPG - Icon free download
CgAlignBottom
align, center, align-center, layout, formatting, text-center, justify-center, ui, design, editor, alignment, toolbar - css.gg Icons - CgAlignCenter - SVG | WEBP | PNG | JPG - Icon free download
CgAlignCenter
align, left, align-left, text-left, justify-left, layout, formatting, editor, design, ui, alignment - css.gg Icons - CgAlignLeft - SVG | WEBP | PNG | JPG - Icon free download
CgAlignLeft
align, middle, center-vertical, align-middle, layout, formatting, editor, design, position, ui - css.gg Icons - CgAlignMiddle - SVG | WEBP | PNG | JPG - Icon free download
CgAlignMiddle
align, right, align-right, text-right, justify-right, layout, editor, design, formatting, ui, alignment - css.gg Icons - CgAlignRight - SVG | WEBP | PNG | JPG - Icon free download
CgAlignRight
align, top, align-top, layout, formatting, editor, justify-top, design, alignment, vertical-align, ui - css.gg Icons - CgAlignTop - SVG | WEBP | PNG | JPG - Icon free download
CgAlignTop
apple, watch, apple-watch, wearable, smartwatch, ios, device, technology, fitness-tracker, electronics, brand, gadget, mobile - css.gg Icons - CgAppleWatch - SVG | WEBP | PNG | JPG - Icon free download
CgAppleWatch
arrow, horizontal-align, align-h, layout, position, justify-horizontal, editor, design, ui, alignment - css.gg Icons - CgArrowAlignH - SVG | WEBP | PNG | JPG - Icon free download
CgArrowAlignH
arrow, vertical-align, align-v, layout, position, justify-vertical, editor, design, ui, alignment - css.gg Icons - CgArrowAlignV - SVG | WEBP | PNG | JPG - Icon free download
CgArrowAlignV
arrow, top, left, top-left, arrow-top-left, diagonal, navigate, back, undo, direction, outline, line-arrow, minimal, ui-button, layout - css.gg Icons - CgArrowTopLeftR - SVG | WEBP | PNG | JPG - Icon free download
CgArrowTopLeftR
arrows, break, horizontal, split, divider, ui-control, navigate, drag, resize, layout, h-split, direction, left-right, horizontal-break - css.gg Icons - CgArrowsBreakeH - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsBreakeH
arrows, break, vertical, split, divider, ui-control, navigate, drag, resize, layout, v-split, direction, up-down, vertical-break - css.gg Icons - CgArrowsBreakeV - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsBreakeV
arrows, expand, left, alt, resize, stretch, direction, ui-control, sidebar, layout - css.gg Icons - CgArrowsExpandLeftAlt - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsExpandLeftAlt
arrows, expand, up-left, resize, layout, direction, ui-action - css.gg Icons - CgArrowsExpandUpLeft - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsExpandUpLeft
arrows, expand, up-right, resize, move, layout, direction, ui-control - css.gg Icons - CgArrowsExpandUpRight - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsExpandUpRight
arrows, shrink, horizontal, arrows-shrink-h, compress, collapse, resize, horizontal-resize, ui-control, layout, toolbar-action, button, interactive, drag, adjust, screen-fit - css.gg Icons - CgArrowsShrinkH - SVG | WEBP | PNG | JPG - Icon free download
CgArrowsShrinkH
battery, empty, low-battery, power, charge, status, warning, device, energy, indicator - css.gg Icons - CgBatteryEmpty - SVG | WEBP | PNG | JPG - Icon free download
CgBatteryEmpty
battery, full, charged, power, energy, device, status, indicator, ready - css.gg Icons - CgBatteryFull - SVG | WEBP | PNG | JPG - Icon free download
CgBatteryFull
battery, power, energy, charge, device, indicator, status, monitor - css.gg Icons - CgBattery - SVG | WEBP | PNG | JPG - Icon free download
CgBattery
board, whiteboard, task-board, kanban, planning, organize, layout, workspace, project, dashboard, notes, sticky-notes, scrum, agile, todo, ui-element, widget - css.gg Icons - CgBoard - SVG | WEBP | PNG | JPG - Icon free download
CgBoard
border, border-all, grid, layout, frame, outline, container, editor, design-tool, ui-builder, css, table-grid, box-model - css.gg Icons - CgBorderAll - SVG | WEBP | PNG | JPG - Icon free download
CgBorderAll
border-bottom, border, layout, underline, separator, rule, css, ui-builder, frame, container, design-tool, editor - css.gg Icons - CgBorderBottom - SVG | WEBP | PNG | JPG - Icon free download
CgBorderBottom
border-left, border, layout, divider, frame, css, ui-builder, design, editor, container, side-border - css.gg Icons - CgBorderLeft - SVG | WEBP | PNG | JPG - Icon free download
CgBorderLeft
border-right, border, layout, side-border, divider, css, frame, container, ui-builder, design-tool - css.gg Icons - CgBorderRight - SVG | WEBP | PNG | JPG - Icon free download
CgBorderRight
border-style, dashed, border, dash, line-style, outline, css, design-tool, ui-builder, editor, separator, frame - css.gg Icons - CgBorderStyleDashed - SVG | WEBP | PNG | JPG - Icon free download
CgBorderStyleDashed
border-style, dotted, border, dots, outline, css, ui-builder, editor, design-tool, frame, separator - css.gg Icons - CgBorderStyleDotted - SVG | WEBP | PNG | JPG - Icon free download
CgBorderStyleDotted
border-style, solid, border, outline, css, design-tool, editor, ui-builder, frame, component-style - css.gg Icons - CgBorderStyleSolid - SVG | WEBP | PNG | JPG - Icon free download
CgBorderStyleSolid
border-top, border, layout, top-border, css, separator, design-tool, frame, editor, container - css.gg Icons - CgBorderTop - SVG | WEBP | PNG | JPG - Icon free download
CgBorderTop
browser, web, internet, window, tab, site, webpage, ui, internet-app, navigation, address-bar, developer-tool, frontend - css.gg Icons - CgBrowser - SVG | WEBP | PNG | JPG - Icon free download
CgBrowser
cast, stream, chromecast, airplay, screen-share, mirror, broadcast, wifi, wireless, device, media, tv - css.gg Icons - CgCast - SVG | WEBP | PNG | JPG - Icon free download
CgCast
cg, collage, grid, layout, photos, images, gallery, mosaic, thumbnail, editor, design, creative, portfolio, template, upload, button, icon, line, ui - css.gg Icons - CgCollage - SVG | WEBP | PNG | JPG - Icon free download
CgCollage
comedy, central, comedy-central, brand, logo, tv, media, entertainment, channel, network, brand-icon, show, humor, funny - css.gg Icons - CgComedyCentral - SVG | WEBP | PNG | JPG - Icon free download
CgComedyCentral
components, modules, blocks, ui-components, elements, widgets, layout, interface, design-system, component-library, react, web-dev, structure, module, building-block - css.gg Icons - CgComponents - SVG | WEBP | PNG | JPG - Icon free download
CgComponents
compress, left, compress-left, shrink, collapse, arrow-left, side-collapse, ui-control, panel, layout, resize, compact, sidebar-hide, direction, navigation - css.gg Icons - CgCompressLeft - SVG | WEBP | PNG | JPG - Icon free download
CgCompressLeft
compress, right, compress-right, shrink, collapse, arrow-right, side-collapse, ui-control, panel, layout, resize, compact, sidebar-hide, direction, navigation - css.gg Icons - CgCompressRight - SVG | WEBP | PNG | JPG - Icon free download
CgCompressRight
compress, vertical, compress-v, shrink, collapse, ui, resize, panel, layout-control, up-down, vertical-adjust, window, compact, toolbar - css.gg Icons - CgCompressV - SVG | WEBP | PNG | JPG - Icon free download
CgCompressV
compress, shrink, collapse, contract, resize, panel, ui, layout, compact, direction, utility, button - css.gg Icons - CgCompress - SVG | WEBP | PNG | JPG - Icon free download
CgCompress
controller, gamepad, gaming, joystick, play, video-game, console, interactive, buttons, entertainment, device, gamer, input-device - css.gg Icons - CgController - SVG | WEBP | PNG | JPG - Icon free download
CgController
dark, mode, dark-mode, theme, night, display, ui, ux, brightness, toggle, appearance, system, preferences, contrast, night-mode, switch - css.gg Icons - CgDarkMode - SVG | WEBP | PNG | JPG - Icon free download
CgDarkMode
desktop, computer, monitor, screen, pc, display, workstation, device, setup, ui, window, dashboard, workspace, hardware, electronics, home screen, office desk, system ui, toolbar icon, menu icon, panel, layout, productivity, coding setup, developer tools, tech - css.gg Icons - CgDesktop - SVG | WEBP | PNG | JPG - Icon free download
CgDesktop
display, flex, css flex, flexbox, layout, web design, frontend, arrange, responsive, ui layout, container, css property, developer, align, justify, code, interface structure - css.gg Icons - CgDisplayFlex - SVG | WEBP | PNG | JPG - Icon free download
CgDisplayFlex
display, fullwidth, full width, wide, stretch, layout, responsive, ui, container, editor, web design, column, full screen width, expand, page layout - css.gg Icons - CgDisplayFullwidth - SVG | WEBP | PNG | JPG - Icon free download
CgDisplayFullwidth
grid, display grid, css grid, layout, columns, rows, web design, structure, interface, frontend, responsive, pattern, table layout, editor, code - css.gg Icons - CgDisplayGrid - SVG | WEBP | PNG | JPG - Icon free download
CgDisplayGrid
display, spacing, gap, padding, margin, css spacing, layout, responsive, spacing adjustment, web design, editor, frontend, ui controls - css.gg Icons - CgDisplaySpacing - SVG | WEBP | PNG | JPG - Icon free download
CgDisplaySpacing
distribute, horizontal, align, even spacing, layout, arrange, ui design, elements, editor, frontend, grid, interface tools, web design - css.gg Icons - CgDistributeHorizontal - SVG | WEBP | PNG | JPG - Icon free download
CgDistributeHorizontal
distribute, vertical, align, even spacing, layout, arrange, ui design, elements, editor, frontend, column, interface tools, web design - css.gg Icons - CgDistributeVertical - SVG | WEBP | PNG | JPG - Icon free download
CgDistributeVertical
dock, bottom, toolbar, panel, attach, ui layout, window, position, footer, stick bottom, layout panel, editor, frontend, interface design - css.gg Icons - CgDockBottom - SVG | WEBP | PNG | JPG - Icon free download
CgDockBottom
dock, left, sidebar, panel, attach, ui layout, navigation, window, position, layout panel, left side, editor, frontend, interface design - css.gg Icons - CgDockLeft - SVG | WEBP | PNG | JPG - Icon free download
CgDockLeft
dock, right, sidebar, panel, attach, ui layout, navigation, window, position, layout panel, right side, editor, frontend, interface design - css.gg Icons - CgDockRight - SVG | WEBP | PNG | JPG - Icon free download
CgDockRight
dock, window, dock window, ui window, panel, sidebar, layout, workspace, desktop, toolbar, modal, frame, ui element, navigation, window manager, app window, window layout, split view, multiwindow, productivity, designer tools, editor, dashboard, interface block, container - css.gg Icons - CgDockWindow - SVG | WEBP | PNG | JPG - Icon free download
CgDockWindow
dolby, brand, audio, surround sound, dolby audio, dolby digital, cinema, hd audio, sound quality, speaker, streaming, movie, tv, theater, sound tech, audio enhancement, media playback, entertainment, sound system, hi fi, immersive sound - css.gg Icons - CgDolby - SVG | WEBP | PNG | JPG - Icon free download
CgDolby
drive, storage, disk, hard drive, cloud drive, data, file storage, backup, documents, archive, system, device, external drive, folder, file manager, data management, server drive, sync, cloud storage, upload, download, directory - css.gg Icons - CgDrive - SVG | WEBP | PNG | JPG - Icon free download
CgDrive
exposure, edit exposure, photo exposure, image edit, lighting, brightness, highlight, shadow, camera, dslr, image control, editor, filter, tone curve, ui, toolbar, panel, lens, iso, web app, mobile app - css.gg Icons - CgEditExposure - SVG | WEBP | PNG | JPG - Icon free download
CgEditExposure
highlight, edit highlight, lighten, exposure, brightness, photo edit, image highlight, editor, filter, tone, contrast, ui tool, design tool, masking, lighting, panel, toolbar, adjust - css.gg Icons - CgEditHighlight - SVG | WEBP | PNG | JPG - Icon free download
CgEditHighlight
mask, edit mask, layer mask, selection, cutout, image mask, photo edit, editor, design tool, masking, overlay, alpha mask, vector mask, ui tool, panel, workflow, effects, highlight, adjustment mask - css.gg Icons - CgEditMask - SVG | WEBP | PNG | JPG - Icon free download
CgEditMask
noise, edit noise, grain, texture, photo edit, effect, filter, roughness, image tools, design, editor, ui control, visual effect, film grain, distortion, panel, artifact, creative, tone - css.gg Icons - CgEditNoise - SVG | WEBP | PNG | JPG - Icon free download
CgEditNoise
shadows, edit shadows, darken, shadow control, tone, photo edit, image tools, editor, ui tool, filter, contrast, exposure, lighting, panel, blend, creative, adjust, retouch, depth - css.gg Icons - CgEditShadows - SVG | WEBP | PNG | JPG - Icon free download
CgEditShadows
eject, media eject, remove, disk eject, device, cd, dvd, usb, safely remove, media control, button, playback, stop, hardware action, storage, system control, exit, popup, tray, drive - css.gg Icons - CgEject - SVG | WEBP | PNG | JPG - Icon free download
CgEject
ereader, ebook, reader, digital book, tablet, kindle, reading, study, learning, content, article, news, document, device, mobile, screen, text, library, education, publication - css.gg Icons - CgEreader - SVG | WEBP | PNG | JPG - Icon free download
CgEreader
ethernet, lan, network cable, wired network, connection, port, internet, router, switch, infrastructure, hardware, signal, data, communication, technology, link, connector, cable, network device, wired - css.gg Icons - CgEthernet - SVG | WEBP | PNG | JPG - Icon free download
CgEthernet
expand, resize, fullscreen, maximize, enlarge, zoom out, layout, window, ui control, open, spread, screen, navigation, button, toolbar, interaction, panel, modal, popout, desktop, mobile, fluid layout - css.gg Icons - CgExpand - SVG | WEBP | PNG | JPG - Icon free download
CgExpand
eye, view, show, visibility, preview, look, watch, monitor, reveal, password visibility, see, focus, eye alt, ux, ui, toggle, vision, profile, observation - css.gg Icons - CgEyeAlt - SVG | WEBP | PNG | JPG - Icon free download
CgEyeAlt
eye, view, see, visibility, preview, look, watch, monitor, focus, password toggle, show, display, observe, ux, ui, profile, vision, insight - css.gg Icons - CgEye - SVG | WEBP | PNG | JPG - Icon free download
CgEye
figma, figma logo, design, ui, ux, wireframe, prototype, branding, collaboration, editor, tool, software, vector, interface, workspace, design system, teamwork - css.gg Icons - CgFigma - SVG | WEBP | PNG | JPG - Icon free download
CgFigma
folder add, folder, add folder, new folder, create folder, directory, file system, storage, workspace, documents, organization, plus, add, insert, new, ui, toolbar, menu, button, sidebar, file manager, explorer, ios, android, web app, content management, structure, project - css.gg Icons - CgFolderAdd - SVG | WEBP | PNG | JPG - Icon free download
CgFolderAdd
folder, directory, file, file manager, storage, documents, workspace, organization, project folder, explorer, ui, toolbar, button, menu, sidebar, content management, cms, file system, ios, android, web app, structure - css.gg Icons - CgFolder - SVG | WEBP | PNG | JPG - Icon free download
CgFolder
font height, text height, line height, typography, font size, text spacing, editor, formatting, ui, toolbar, design, content, document, adjust, spacing, layout, web design, css, writing, editing, ios, android, web app - css.gg Icons - CgFontHeight - SVG | WEBP | PNG | JPG - Icon free download
CgFontHeight
font spacing, letter spacing, kerning, typography, text spacing, editor, format, adjust, design, layout, ui, toolbar, document, content, writing, css, text editor, ios, android, web app - css.gg Icons - CgFontSpacing - SVG | WEBP | PNG | JPG - Icon free download
CgFontSpacing
center, format center, text center, align center, alignment, typography, editor, layout, formatting, ui, toolbar, document, content, writing, css, web design, ios, android, web app - css.gg Icons - CgFormatCenter - SVG | WEBP | PNG | JPG - Icon free download
CgFormatCenter
heading, format heading, h1, h2, title text, typography, editor, document, section title, layout, formatting, ui, toolbar, content, writing, css, web design, ios, android, web app - css.gg Icons - CgFormatHeading - SVG | WEBP | PNG | JPG - Icon free download
CgFormatHeading
indent decrease, outdent, format indent decrease, reduce indent, text indent, typography, editor, formatting, layout, ui, toolbar, document, content, writing, css, web design, ios, android, web app - css.gg Icons - CgFormatIndentDecrease - SVG | WEBP | PNG | JPG - Icon free download
CgFormatIndentDecrease
justify, text justify, full alignment, alignment, paragraph, editor, rich text, formatting, document layout, text block, ui control, toolbar, content alignment, word processor, writing tools, presentation, column layout, markdown - css.gg Icons - CgFormatJustify - SVG | WEBP | PNG | JPG - Icon free download
CgFormatJustify
right align, align right, text right, alignment, paragraph, editor, rich text, formatting, document layout, writing tools, ui control, toolbar button, page builder, content alignment, presentation - css.gg Icons - CgFormatRight - SVG | WEBP | PNG | JPG - Icon free download
CgFormatRight
google, brand, logo, search, engine, internet, browser, gmail, maps, drive, workspace, web, chrome, android, seo, indexing, homepage, header icon, footer icon, sidebar icon - css.gg Icons - CgGoogle - SVG | WEBP | PNG | JPG - Icon free download
CgGoogle
home screen, mobile, screen, layout, homepage, dashboard, ui, navigation, start, welcome, root page, panel, app home, tablet, smartphone - css.gg Icons - CgHomeScreen - SVG | WEBP | PNG | JPG - Icon free download
CgHomeScreen
inbox, mailbox, messages, email, incoming, notification, queue, tasks, workspace, storage, inbox tray, communication, receive, documents, files, mail center, message center, folder inbox, new items, task list - css.gg Icons - CgInbox - SVG | WEBP | PNG | JPG - Icon free download
CgInbox
keyboard, typing, input, keys, hardware, device, text entry, computer, pc, laptop, keyboard shortcut, command, controls, accessibility, editor input, ui input - css.gg Icons - CgKeyboard - SVG | WEBP | PNG | JPG - Icon free download
CgKeyboard
laptop, computer, notebook, pc, device, workstation, tech, desktop replacement, coding, developer, designer, ui, dashboard, workspace, remote work, portable device, electronics, hardware, screen, monitor, browser, web app, toolbar, menu - css.gg Icons - CgLaptop - SVG | WEBP | PNG | JPG - Icon free download
CgLaptop
layout, grid, small grid, tiles, modules, blocks, cards, ui layout, dashboard grid, gallery, thumbnails, matrix, arrangement, interface structure, components, widgets, organize, template, preview - css.gg Icons - CgLayoutGridSmall - SVG | WEBP | PNG | JPG - Icon free download
CgLayoutGridSmall
layout, grid, gallery, tiles, matrix, modules, cards, ui grid, dashboard, widgets, preview layout, template, arrangement, structure, interface, components, content blocks - css.gg Icons - CgLayoutGrid - SVG | WEBP | PNG | JPG - Icon free download
CgLayoutGrid
layout, list, rows, bullet list, menu list, items, vertical list, text blocks, document items, notes, todo list, structure, ui layout, content organization, read mode, sidebar list - css.gg Icons - CgLayoutList - SVG | WEBP | PNG | JPG - Icon free download
CgLayoutList
layout, pin, pinned, sticky, bookmark, save, remember, pinboard, priority, flag item, highlight, mark, ui pin, dashboard pin, fixed position, organize - css.gg Icons - CgLayoutPin - SVG | WEBP | PNG | JPG - Icon free download
CgLayoutPin
maximize, alt maximize, full screen, expand, window expand, resize, ui control, screen mode, enlarge, layout change, desktop, window button, panel expand, toggle, ios, android, web interface - css.gg Icons - CgMaximizeAlt - SVG | WEBP | PNG | JPG - Icon free download
CgMaximizeAlt
maximize, expand, full screen, resize, window enlarge, zoom out frame, ui control, panel expand, layout action, screen toggle, workspace, window tool, toggle size, ios, android, desktop app - css.gg Icons - CgMaximize - SVG | WEBP | PNG | JPG - Icon free download
CgMaximize
menu, boxed menu, grid menu, container menu, navigation, ui menu, hamburger alt, options, list, panel, sidebar, toolbar, header menu, mobile menu, ios, android, web navigation - css.gg Icons - CgMenuBoxed - SVG | WEBP | PNG | JPG - Icon free download
CgMenuBoxed
menu grid, grid o, grid menu, navigation, grid layout, tiles, app launcher, options, dashboard menu, panel, toolbar, ui component, ios, android, web menu, button - css.gg Icons - CgMenuGridO - SVG | WEBP | PNG | JPG - Icon free download
CgMenuGridO
menu, left, alt, left menu, menu left alt, sidebar toggle, drawer open, nav open, navigation, panel, layout control, header, toolbar button, mobile, responsive, svg, cssgg, react-icons, ux, ui, sidebar, toggle - css.gg Icons - CgMenuLeftAlt - SVG | WEBP | PNG | JPG - Icon free download
CgMenuLeftAlt
menu, left, left menu, sidebar toggle, drawer, nav, navigation, panel, menu button, header, toolbar, mobile, responsive, svg, cssgg, react-icons, ux, ui, toggle, open, close - css.gg Icons - CgMenuLeft - SVG | WEBP | PNG | JPG - Icon free download
CgMenuLeft
menu, right, alt, right menu, menu right alt, sidebar toggle, drawer, nav, panel, layout control, toolbar button, mobile, responsive, svg, cssgg, react-icons, ux, ui, toggle, open, close - css.gg Icons - CgMenuRightAlt - SVG | WEBP | PNG | JPG - Icon free download
CgMenuRightAlt
menu, right, right menu, sidebar toggle, drawer, navigation, panel, menu button, toolbar, header, mobile, responsive, svg, cssgg, react-icons, ux, ui, toggle, open, close - css.gg Icons - CgMenuRight - SVG | WEBP | PNG | JPG - Icon free download
CgMenuRight
merge, horizontal, merge horizontal, combine, join, align, layout, ui, grid, columns, rows, arrange, editor, design, interface, workflow, toolbar, action, organize, page builder, responsive layout, split, unify - css.gg Icons - CgMergeHorizontal - SVG | WEBP | PNG | JPG - Icon free download
CgMergeHorizontal
merge, vertical, merge vertical, combine, join, stack, align, layout, ui, rows, columns, arrange, editor, design, interface, workflow, toolbar, action, organize, builder, page structure, responsive - css.gg Icons - CgMergeVertical - SVG | WEBP | PNG | JPG - Icon free download
CgMergeVertical
mic, microphone, audio, record, voice, sound, speech, talk, podcast, radio, broadcast, call, input, studio, music, sing, chat, communication, device, mute, unmute, toolbar, ui button - css.gg Icons - CgMic - SVG | WEBP | PNG | JPG - Icon free download
CgMic
microbit, micro bit, board, microcontroller, iot, hardware, chips, coding, programming, maker, electronics, prototyping, development board, education, robotics, embedded, device, wearable, stem - css.gg Icons - CgMicrobit - SVG | WEBP | PNG | JPG - Icon free download
CgMicrobit
minimize, alt minimize, window control, reduce, collapse, shrink, ui action, toolbar, taskbar, modal, dialog, panel, hide, compact, layout control, system, navigation, button - css.gg Icons - CgMinimizeAlt - SVG | WEBP | PNG | JPG - Icon free download
CgMinimizeAlt
minimize, window minimize, collapse, reduce, shrink, ui action, toolbar, system, window, taskbar, modal, dialog, compact mode, panel, hide, layout, navigation, button - css.gg Icons - CgMinimize - SVG | WEBP | PNG | JPG - Icon free download
CgMinimize
modem, network, router, internet, wifi, connection, broadband, ethernet, signal, lan, wan, device, hardware, iot, gateway, telecom, provider, network setup, bandwidth, data transfer - css.gg Icons - CgModem - SVG | WEBP | PNG | JPG - Icon free download
CgModem
mouse, computer mouse, pointer device, click, scroll, input, hardware, cursor, pc, mac, device control, usb mouse, bluetooth mouse, gaming mouse, navigation, ui interaction, desktop ui - css.gg Icons - CgMouse - SVG | WEBP | PNG | JPG - Icon free download
CgMouse
oculus, meta, vr, virtual reality, headset, gaming, vr device, immersive, 3d, simulation, vr experience, technology brand, logo, hardware, goggles, vr platform, gaming gear, entertainment, brand icon - css.gg Icons - CgOculus - SVG | WEBP | PNG | JPG - Icon free download
CgOculus
options, settings, controls, preferences, menu, toggle, configure, customize, adjust, gear, ui controls, toolbar, panel, system settings, user settings, form option, select, menu item, hover state, active state - css.gg Icons - CgOptions - SVG | WEBP | PNG | JPG - Icon free download
CgOptions
pentagon, bottom left, geometric shape, polygon, shape, layout element, decorative shape, corner indicator, ui marker, graphic design, geometry, position, alignment, direction, vector shape, outline shape, symbol, container shape, frame - css.gg Icons - CgPentagonBottomLeft - SVG | WEBP | PNG | JPG - Icon free download
CgPentagonBottomLeft
pentagon, bottom right, geometric shape, polygon, shape, layout element, decorative, corner indicator, ui marker, vector shape, design shape, geometry, direction, alignment, frame, outline polygon, graphic asset - css.gg Icons - CgPentagonBottomRight - SVG | WEBP | PNG | JPG - Icon free download
CgPentagonBottomRight
pentagon, left, geometric shape, polygon, shape, direction left, arrow alt, layout marker, decorative element, vector polygon, geometry, outline shape, ui indicator, design asset, frame, symbol - css.gg Icons - CgPentagonLeft - SVG | WEBP | PNG | JPG - Icon free download
CgPentagonLeft
pentagon, up, geometric shape, polygon, shape, direction up, arrow alt, geometry, vector polygon, layout indicator, outline shape, ui marker, decorative element, design shape, frame - css.gg Icons - CgPentagonUp - SVG | WEBP | PNG | JPG - Icon free download
CgPentagonUp
phone, mobile, smartphone, cell phone, call, dial, contact, communication, device, ios, android, handset, telephony, voice, incoming, outgoing, toolbar, button, ui, connect, ring, messaging, chat - css.gg Icons - CgPhone - SVG | WEBP | PNG | JPG - Icon free download
CgPhone
photo scan, scan, camera, photo, image scan, scanner, qr scan, document scan, capture, camera app, editor, media, picture, frame, detect, analysis, barcode, vision, preview, ui action, toolbar, import - css.gg Icons - CgPhotoscan - SVG | WEBP | PNG | JPG - Icon free download
CgPhotoscan
pin, marker, map pin, location, point, place, tag, bookmark, save, note, highlight, pointer, organize, task, reminder, sticky, ui button, layout - css.gg Icons - CgPin - SVG | WEBP | PNG | JPG - Icon free download
CgPin
plug, power plug, connector, electric, socket, charge, charging, energy, power, cable, hardware, device, iot, connection, link, utility, settings, electronics, adapter, plugin, extension - css.gg Icons - CgPlug - SVG | WEBP | PNG | JPG - Icon free download
CgPlug
presentation, slides, projector, screen, whiteboard, meeting, pitch, business, office, classroom, teach, demo, analytics, charts, report, briefing, workspace, productivity - css.gg Icons - CgPresentation - SVG | WEBP | PNG | JPG - Icon free download
CgPresentation
printer, print, device, hardware, office, document, paper, copy, scan, output, file, stationery, settings, utility, peripheral, workstation - css.gg Icons - CgPrinter - SVG | WEBP | PNG | JPG - Icon free download
CgPrinter
ratio, proportion, scale, measurement, comparison, analytics, math, statistics, data, metric, aspect ratio, graphing, calculation, ui metric, dashboard, reporting, design tool, editor tool, layout planning, numeric indicator - css.gg Icons - CgRatio - SVG | WEBP | PNG | JPG - Icon free download
CgRatio
remote, controller, remote control, iot, device, media, tv remote, smart home, automation, bluetooth, signal, infrared, control panel, electronics, settings, input device, android, ios, ui control - css.gg Icons - CgRemote - SVG | WEBP | PNG | JPG - Icon free download
CgRemote
screen mirror, cast, mirroring, screen share, display cast, wireless display, airplay, project screen, presentation, remote display, stream screen, monitor share, connect device - css.gg Icons - CgScreenMirror - SVG | WEBP | PNG | JPG - Icon free download
CgScreenMirror
screenshot, screen shot, capture screen, capture, snapshot, screen capture, monitor, display, grab, ui tool, toolbar, button, action, frame, crop, selection, snip, snipping, windows capture, mac capture, ios, android, overlay, record, save, export, utility - css.gg Icons - CgScreenShot - SVG | WEBP | PNG | JPG - Icon free download
CgScreenShot
wide screen, screen wide, monitor, display, widescreen, ultrawide, desktop, resolution, aspect ratio, landscape, tv, presentation, workspace, layout, frame, panel, ui frame, window, hardware, device - css.gg Icons - CgScreenWide - SVG | WEBP | PNG | JPG - Icon free download
CgScreenWide
screen, monitor, display, desktop, device, frame, window, layout, resolution, panel, tv, presentation, workstation, ui, hardware, system panel, viewport, app window - css.gg Icons - CgScreen - SVG | WEBP | PNG | JPG - Icon free download
CgScreen
shape, square, box, tile, geometry, block, vector, frame, container, logo shape, placeholder, ui element, layout grid, editor tool, simple shape - css.gg Icons - CgShapeSquare - SVG | WEBP | PNG | JPG - Icon free download
CgShapeSquare
sidebar open, sidebar, open panel, navigation drawer, left menu, ui panel, layout, expand, drawer, menu open, workspace, column, panel view, ios, android, responsive ui, web app, dashboard, split view - css.gg Icons - CgSidebarOpen - SVG | WEBP | PNG | JPG - Icon free download
CgSidebarOpen
sidebar right, right panel, navigation drawer, panel, drawer, column right, layout control, workspace, toggle panel, ui component, responsive layout, menu, expand panel, ios, android, web, fluent ui style - css.gg Icons - CgSidebarRight - SVG | WEBP | PNG | JPG - Icon free download
CgSidebarRight
sidebar, panel, drawer, menu, navigation bar, layout, column, ui container, panel view, toggle menu, workspace, dashboard, responsive ui, ios, android, web, material style - css.gg Icons - CgSidebar - SVG | WEBP | PNG | JPG - Icon free download
CgSidebar
size, resize, dimension, scale, measure, layout control, ui sizing, expand, shrink, bounding box, viewport, editor tool, design utility, responsive, flexbox, grid, width, height, aspect ratio - css.gg Icons - CgSize - SVG | WEBP | PNG | JPG - Icon free download
CgSize
slack, brand, chat, messaging, team, workspace, collaboration, communication, work chat, channels, dm, company communication, remote work, notifications, productivity app, teamwork, group chat, workflows - css.gg Icons - CgSlack - SVG | WEBP | PNG | JPG - Icon free download
CgSlack
smartphone chip, chip, processor, mobile chip, cpu, hardware, device, phone, smartphone, silicon, core, performance, speed, mobile hardware, tech, electronics, embedded, board, circuit, component, engineering, optimization, ui icon, toolbar - css.gg Icons - CgSmartphoneChip - SVG | WEBP | PNG | JPG - Icon free download
CgSmartphoneChip
smartphone ram, ram, memory, device memory, mobile ram, hardware, smartphone, phone, performance, speed, multitasking, mobile hardware, specs, memory module, optimization, system, ui icon, toolbar - css.gg Icons - CgSmartphoneRam - SVG | WEBP | PNG | JPG - Icon free download
CgSmartphoneRam
smartphone, phone, mobile, device, cellphone, touchscreen, handheld, communication, call, sms, app, ios, android, ui icon, navigation, toolbar, mobile device, electronics - css.gg Icons - CgSmartphone - SVG | WEBP | PNG | JPG - Icon free download
CgSmartphone
software, download, install, save, file download, arrow down, package, install app, setup, binary, update, offline, pc, desktop, button, cta, toolbar, ui action, transfer, data - css.gg Icons - CgSoftwareDownload - SVG | WEBP | PNG | JPG - Icon free download
CgSoftwareDownload
space, vertical space, space between, alignment, layout, flexbox, css, design tool, editor, ui spacing, vertical alignment, component layout, grid, container, web design, ux - css.gg Icons - CgSpaceBetweenV - SVG | WEBP | PNG | JPG - Icon free download
CgSpaceBetweenV
space, horizontal space, space between, alignment, layout, flexbox, css, design tool, ui spacing, editor, component layout, grid, container, web design, ux, horizontal alignment - css.gg Icons - CgSpaceBetween - SVG | WEBP | PNG | JPG - Icon free download
CgSpaceBetween
studio, creative, editing, workspace, media production, design studio, content creation, creative suite, film, audio, video, art tools, digital studio, creator, css gg - css.gg Icons - CgStudio - SVG | WEBP | PNG | JPG - Icon free download
CgStudio
tab, browser tab, ui tab, page tab, section, navigation, switch view, panel, layout, window, multitask, header, toolbar, menu, content switch, interaction - css.gg Icons - CgTab - SVG | WEBP | PNG | JPG - Icon free download
CgTab
template, layout, design template, wireframe, structure, grid, content block, dashboard layout, page builder, mockup, ui template, framework, component layout, editor, web design, prototype, content planning, layout tool, ui kit - css.gg Icons - CgTemplate - SVG | WEBP | PNG | JPG - Icon free download
CgTemplate
terrain, landscape, topography, map, geography, mountains, hills, elevation, outdoor, environment, nature, hiking, navigation, map layers, geo data, earth surface - css.gg Icons - CgTerrain - SVG | WEBP | PNG | JPG - Icon free download
CgTerrain
toolbox, tools, kit, work tools, repair, maintenance, builder, developer tools, settings, gear, utilities, hardware, construction, workshop, equipment, ui tools, toolbar, admin, configuration, setup, fix, patch, upgrade, utility box, portable tools, engineer tools, craftsman - css.gg Icons - CgToolbox - SVG | WEBP | PNG | JPG - Icon free download
CgToolbox
touchpad, trackpad, laptop input, gesture, pointer, cursor control, device input, hardware, ui navigation, scroll, tap, swipe, touch control, mouse alternative, input device, accessibility input, mobile gesture, track surface, navigation, movement control - css.gg Icons - CgTouchpad - SVG | WEBP | PNG | JPG - Icon free download
CgTouchpad
track, tracking, follow, monitor, path, route, navigation, delivery status, shipment, progress, timeline, transport, gps track, location path, logistics, route progress, map planning, status flow, journey, movement tracking, workflow track, progress route - css.gg Icons - CgTrack - SVG | WEBP | PNG | JPG - Icon free download
CgTrack
tree, forest, plant, nature, eco, ecology, environment, greenery, organic, outdoor, landscape, wood, flora, park, garden, nature icon, sustainability, growth, natural element, leafy tree, wildlife - css.gg Icons - CgTree - SVG | WEBP | PNG | JPG - Icon free download
CgTree
trees, forest, woods, plants, nature, eco, ecology, environment, greenery, natural, outdoor, landscape, park, garden, wildlife, multiple trees, nature scene, vegetation, organic, natural growth - css.gg Icons - CgTrees - SVG | WEBP | PNG | JPG - Icon free download
CgTrees
tv, television, screen, display, monitor, video, stream, broadcast, media, entertainment, show, movie, series, watch, smart tv, home theater, device, program, display unit, electronics, output device - css.gg Icons - CgTv - SVG | WEBP | PNG | JPG - Icon free download
CgTv
uikit, ui kit, interface, design system, components, ux, layout, library, framework, prototype, widgets, frontend, developer, template, module, ui elements, toolkit, kit, design library, theme, styles - css.gg Icons - CgUiKit - SVG | WEBP | PNG | JPG - Icon free download
CgUiKit
usb c, connector, type c, port, cable, charger, data transfer, hardware, plug, peripheral, connection, device io, laptop port, phone charging, high speed, usb type c - css.gg Icons - CgUsbC - SVG | WEBP | PNG | JPG - Icon free download
CgUsbC
usb, connector, port, cable, plug, data transfer, hardware, peripheral, external drive, adapter, charging, io port, computer accessories, usb standard - css.gg Icons - CgUsb - SVG | WEBP | PNG | JPG - Icon free download
CgUsb
view, cols, columns, view columns, grid, layout, multi column, split layout, dashboard view, table view, ui layout, content arrangement, responsive design, panel, section, organize, sort layout, toggle view, sidebar, editor - css.gg Icons - CgViewCols - SVG | WEBP | PNG | JPG - Icon free download
CgViewCols
view comfortable, comfortable view, layout, spacious layout, grid, list, content spacing, ui density, density toggle, readability, clean layout, design system, ux, toggle view, minimal layout, relaxed view - css.gg Icons - CgViewComfortable - SVG | WEBP | PNG | JPG - Icon free download
CgViewComfortable
website, web, internet, browser, homepage, webpage, site, domain, online, www, frontend, development, web design, ui, layout, global, portal, seo, dashboard, landing page - css.gg Icons - CgWebsite - SVG | WEBP | PNG | JPG - Icon free download
CgWebsite
windows, microsoft, os, operating system, pc, desktop, brand, logo, win, software, system ui, platform, computer, tech brand, startup screen - css.gg Icons - CgWindows - SVG | WEBP | PNG | JPG - Icon free download
CgWindows
align, bottom, align bottom, layout, ui alignment, design tool, editor, formatting, positioning, vertical alignment, content placement, toolbar, grid, layout editing, alignment control, ios, android, web app, graphics tool, designer ui - Circum Icons - CiAlignBottom - SVG | WEBP | PNG | JPG - Icon free download
CiAlignBottom
align, center, horizontal, align center horizontal, center h, horizontal alignment, layout, design tool, editor, formatting, positioning, ui layout, content alignment, graphic editor, center content, toolbar, ios, android, web design - Circum Icons - CiAlignCenterH - SVG | WEBP | PNG | JPG - Icon free download
CiAlignCenterH
align, center, vertical, align center vertical, center v, vertical alignment, layout, formatting, design tool, editor, content alignment, graphic editor, position, layout control, center content, toolbar action, ios, android, web layout - Circum Icons - CiAlignCenterV - SVG | WEBP | PNG | JPG - Icon free download
CiAlignCenterV
align, left, align left, text alignment, layout, formatting, editor, left justify, paragraph align, design tool, content placement, ui layout, toolbar, graphic editor, web design, ios, android - Circum Icons - CiAlignLeft - SVG | WEBP | PNG | JPG - Icon free download
CiAlignLeft
align, right, align right, text alignment, right justify, formatting, editor, design tool, layout, content placement, text tool, toolbar, graphic editor, ui design, ios, android, web editor - Circum Icons - CiAlignRight - SVG | WEBP | PNG | JPG - Icon free download
CiAlignRight
align, top, align top, vertical alignment, layout, editor, formatting, content placement, design tool, ui layout, graphic editor, position control, top justify, ios, android, web design - Circum Icons - CiAlignTop - SVG | WEBP | PNG | JPG - Icon free download
CiAlignTop
apple, brand, logo, apple logo, mac, iphone, ipad, ios, macos, technology, apple inc, tech brand, computer, smartphone, device, hardware, premium brand, consumer tech, branding, store, app store, ecosystem, apple product, apple icon - Circum Icons - CiApple - SVG | WEBP | PNG | JPG - Icon free download
CiApple
brightness down, brightness, dim, lower brightness, display, screen, monitor, device control, settings, adjust, sun icon, light, dark mode, ui control, toolbar, quick settings, accessibility - Circum Icons - CiBrightnessDown - SVG | WEBP | PNG | JPG - Icon free download
CiBrightnessDown
brightness up, brightness, increase brightness, display, screen, monitor, light, sun, adjust, settings, ui control, toolbar, accessibility, system toggle, quick actions - Circum Icons - CiBrightnessUp - SVG | WEBP | PNG | JPG - Icon free download
CiBrightnessUp
crop, image crop, edit, photo edit, resize, trim, cut, design tool, adjustment, editor, media, toolbar, graphics, aspect ratio, composition, visual editing, photo tool, ui control - Circum Icons - CiCrop - SVG | WEBP | PNG | JPG - Icon free download
CiCrop
dark, dark mode, theme, night, moon, dark theme, appearance, ui theme, display mode, contrast, toggle, switch, preferences, layout, ux, ios, android, web app, header, toolbar icon, settings panel, visual style, night mode - Circum Icons - CiDark - SVG | WEBP | PNG | JPG - Icon free download
CiDark
mouse, desktop mouse, computer mouse, peripheral, pointer, cursor, input device, click, hardware, pc, workstation, office, controller, navigation, ui interaction, ios, android, desktop ui, ergonomics, gadget - Circum Icons - CiDesktopMouse1 - SVG | WEBP | PNG | JPG - Icon free download
CiDesktopMouse1
desktop, computer, monitor, screen, display, pc, workstation, device, hardware, ui, window, os, browser, coding, design, dashboard, frontend, backend, work, office, productivity, tech - Circum Icons - CiDesktop - SVG | WEBP | PNG | JPG - Icon free download
CiDesktop
folder on, active folder, open folder, document folder, file storage, directory, outline folder, line folder, file manager, navigation folder, library folder, workspace, content folder, ui folder, project folder - Circum Icons - CiFolderOn - SVG | WEBP | PNG | JPG - Icon free download
CiFolderOn
grid, grid layout, horizontal grid, 2h grid, layout, columns, rows, structure, organization, dashboard, gallery, cards, ui blocks, modules, section layout, arrange, sort, view mode, display, interface design, responsive, template, container, web layout, editor tool, design system, material, ios, android - Circum Icons - CiGrid2H - SVG | WEBP | PNG | JPG - Icon free download
CiGrid2H
grid, vertical grid, 2v grid, layout, structure, organization, columns, rows, ui grid, cards, gallery, dashboard, view mode, arrange, responsive layout, split view, editor, design pattern, modular ui, blocks, panel layout, sort, template, material, android, ios - Circum Icons - CiGrid2V - SVG | WEBP | PNG | JPG - Icon free download
CiGrid2V
grid, 3x1 grid, three columns, layout, structure, organization, gallery, dashboard, cards, sections, container layout, arrange, modules, blocks, ui design, editor tool, responsive design, list view, matrix, web layout, template, pattern, material style, android, ios - Circum Icons - CiGrid31 - SVG | WEBP | PNG | JPG - Icon free download
CiGrid31
grid, 3x2 grid, layout, matrix, gallery, dashboard, cards, modules, organization, ui blocks, responsive layout, arrange, interface, template, sections, columns, rows, editor, design pattern, material, ios, android, page layout, view modes, split design - Circum Icons - CiGrid32 - SVG | WEBP | PNG | JPG - Icon free download
CiGrid32
grid, 4x1 grid, four columns, layout, structure, template, organization, dashboard, gallery, modules, cards, responsive layout, arrange, editor, design pattern, ui blocks, material, android, ios, page layout, view mode, content display, sections - Circum Icons - CiGrid41 - SVG | WEBP | PNG | JPG - Icon free download
CiGrid41
grid, 4x2 grid, matrix, layout, organization, gallery, dashboard, cards, modules, ui design, responsive, arrange, editor tool, template, blocks, content layout, system design, structure pattern, ios, android, material style, page builder, multi-section - Circum Icons - CiGrid42 - SVG | WEBP | PNG | JPG - Icon free download
CiGrid42
hard drive, storage, disk, hdd, ssd, device, hardware, backup, memory, server, database, data, archive, external drive, internal drive, system storage, tech, computer, pc, drive icon, utility, file management, storage device, capacity, cloud sync, data center, infrastructure, ios, android - Circum Icons - CiHardDrive - SVG | WEBP | PNG | JPG - Icon free download
CiHardDrive
headphones, audio, music, listen, sound, media, earphones, headset, song, playlist, podcast, volume, streaming, entertainment, device, wearable, gaming, bass, audio gear, speaker, sound quality, music app, audio control, relax, studio, dj, ios, android, material - Circum Icons - CiHeadphones - SVG | WEBP | PNG | JPG - Icon free download
CiHeadphones
indent, text indent, format, spacing, paragraph, editor, rich text, layout, alignment, increase indent, decrease indent, writing, document, content, typography, ui control, toolbar action, markdown, code editor, word processor, text styling - Circum Icons - CiIndent - SVG | WEBP | PNG | JPG - Icon free download
CiIndent
keyboard, typing, keys, input device, hardware, computer, laptop, pc, mechanical keyboard, gaming keyboard, hotkeys, shortcut, command, editor, text input, programming, workflow, office, peripheral, device control - Circum Icons - CiKeyboard - SVG | WEBP | PNG | JPG - Icon free download
CiKeyboard
laptop, notebook, computer, pc, device, workstation, programming, coding, remote work, study, office, portable computer, screen, display, tech, hardware, electronics, workflow, online meeting, digital work - Circum Icons - CiLaptop - SVG | WEBP | PNG | JPG - Icon free download
CiLaptop
light, lamp, bulb, illumination, brightness, lighting, toggle, on off, energy, electric, power, home automation, smart light, brightness control, ambient, ui control, household, device, settings, environment - Circum Icons - CiLight - SVG | WEBP | PNG | JPG - Icon free download
CiLight
line height, text spacing, typography, formatting, editor, paragraph spacing, layout, css, web design, writing, document, ui control, text style, line spacing, design tool, content editing, markup, code editor, typesetting, font control - Circum Icons - CiLineHeight - SVG | WEBP | PNG | JPG - Icon free download
CiLineHeight
maximize, expand, full screen, resize, window, ui control, screen, layout, enlarge, open, view, fullscreen toggle, toolbar, button, header, desktop ui, mobile ui, ios, android - Circum Icons - CiMaximize1 - SVG | WEBP | PNG | JPG - Icon free download
CiMaximize1
monitor, screen, display, desktop, computer, pc, workstation, tech, device, ui layout, web design, coding, editor, dashboard, analytics screen, presentation, workspace, hardware, resolution, flat screen, lcd, interface, window, browser, view - Circum Icons - CiMonitor - SVG | WEBP | PNG | JPG - Icon free download
CiMonitor
mountain, mountains, peak, hill, landscape, nature, outdoor, adventure, travel, hiking, trekking, scenery, geography, summit, nature scene, eco, tourism, exploration, natural view, camping, wildlife - Circum Icons - CiMountain1 - SVG | WEBP | PNG | JPG - Icon free download
CiMountain1
monitor, screen, display, desktop, computer, pc, workstation, tech, device, ui layout, web design, coding, editor, dashboard, analytics screen, presentation, workspace, hardware, resolution, flat screen, lcd, interface, window, browser, view - Circum Icons - CiMonitor - SVG | WEBP | PNG | JPG - Icon free download
CiMonitor
mountain, mountains, peak, hill, landscape, nature, outdoor, adventure, travel, hiking, trekking, scenery, geography, summit, nature scene, eco, tourism, exploration, natural view, camping, wildlife - Circum Icons - CiMountain1 - SVG | WEBP | PNG | JPG - Icon free download
CiMountain1
plug, connector, power plug, electric, charging, charge, power, socket, cable, wire, electronics, adapter, energy, device connect, hardware, usb, link, connect, connection, power management, setup, configuration, electricity - Circum Icons - CiPlug1 - SVG | WEBP | PNG | JPG - Icon free download
CiPlug1
power, on, off, shutdown, restart, toggle, energy, power button, system control, startup, device power, hardware, electronics, power icon, power switch, interaction, ui control, toolbar action, system settings - Circum Icons - CiPower - SVG | WEBP | PNG | JPG - Icon free download
CiPower
text align justify, justify text, typography, formatting, alignment, document editor, cms, rich text, layout, full width text, ui control, toolbar button, outline text, content formatting, writing tools - Circum Icons - CiTextAlignJustify - SVG | WEBP | PNG | JPG - Icon free download
CiTextAlignJustify
text align left, align left, left alignment, text, paragraph, editor, document, formatting, typography, layout, ui, toolbar, content, writing, article, note, markdown, wysiwyg, design tool, text block, header, footer, sidebar, alignment control, left justified, text layout, word processor - Circum Icons - CiTextAlignLeft - SVG | WEBP | PNG | JPG - Icon free download
CiTextAlignLeft
text align right, align right, right alignment, text, paragraph, editor, document, formatting, typography, layout, ui, toolbar, content, design tool, writing, markdown, wysiwyg, right justified, text layout, alignment control, word processor, text block - Circum Icons - CiTextAlignRight - SVG | WEBP | PNG | JPG - Icon free download
CiTextAlignRight
usb, connector, port, plug, peripheral, device, storage, flash drive, cable, connection, interface port, hardware, electronics, wired, tech, data transfer, adapter, symbol, io - Circum Icons - CiUsb - SVG | WEBP | PNG | JPG - Icon free download
CiUsb
view board, whiteboard, board, display, presentation, dashboard, analytics, screen, workspace, teaching, education, planning, ui panel, layout, diagram, workflow, organize, visual board - Circum Icons - CiViewBoard - SVG | WEBP | PNG | JPG - Icon free download
CiViewBoard
view column, column layout, columns, grid, table columns, layout, ui layout, dashboard, split view, vertical layout, editor layout, page structure, panel layout, design tool, wireframe, responsive, table view, list grid toggle, sidebar, page sections, sketch, figma, ux, ui - Circum Icons - CiViewColumn - SVG | WEBP | PNG | JPG - Icon free download
CiViewColumn
wave, pulse, waveform, signal, audio, heartbeat, monitor, sensor, oscillation, visualizer, equalizer, spectrum, real-time, live data, streaming, analytics, dashboard, health tracker, iot sensor, media player, sound, voice, widget, control, animation, status, indicator, inspect, measure, visual - Circum Icons - CiWavePulse1 - SVG | WEBP | PNG | JPG - Icon free download
CiWavePulse1
wifi, wifi off, offline, disconnected, no signal, network, wireless, airplane mode, hotspot, router, network error, connectivity issue, status indicator, disabled, troubleshoot, mobile, device, admin, fallback, offline mode, icon, symbol, header, notification, toast, banner, settings - Circum Icons - CiWifiOff - SVG | WEBP | PNG | JPG - Icon free download
CiWifiOff
wifi, wifi on, connected, online, signal, wireless, hotspot, network, strong signal, router, internet, status indicator, connection, pairing, available network, device, mobile, admin, header, footer, toolbar, icon, symbol, badge, ux, connect, wifi-available, network-success, hotspot-available - Circum Icons - CiWifiOn - SVG | WEBP | PNG | JPG - Icon free download
CiWifiOn
android, brand, google, mobile, os, sdk, android logo, kotlin, java, android studio, adb, app, platform, developer, mobile development, play store, apk, device, support, tech stack, tooling, integration, documentation, badge, logo - Devicons - DiAndroid - SVG | WEBP | PNG | JPG - Icon free download
DiAndroid
apple, mac, ios, macos, iphone, ipad, imac, brand logo, tech brand, fruit logo, apple ecosystem, app store, apple developer, design, hardware, smartphone, desktop, laptop, apple icon - Devicons - DiApple - SVG | WEBP | PNG | JPG - Icon free download
DiApple
aptana, ide, editor, web development, html, css, javascript, coding tool, developer environment, runtime, plugin, opensource ide, productivity tool, workspace, project editor, web apps - Devicons - DiAptana - SVG | WEBP | PNG | JPG - Icon free download
DiAptana
atom, editor, text editor, coding, opensource, github editor, syntax, workspace, packages, themes, developer tool, lightweight editor, script editor, project manager, source code, ide alternative - Devicons - DiAtom - SVG | WEBP | PNG | JPG - Icon free download
DiAtom
cloud9, aws cloud9, cloud ide, online editor, ide, coding, developer, workspace, collaboration, cloud tools, remote development, browser ide, env, deployment, coding environment, web ide, programming - Devicons - DiCloud9 - SVG | WEBP | PNG | JPG - Icon free download
DiCloud9
coda, panic coda, text editor, ide, developer tool, mac editor, programming, coding, web development, workspace, syntax, project editor, software tools, tech, developer environment, frontend, backend - Devicons - DiCoda - SVG | WEBP | PNG | JPG - Icon free download
DiCoda
compass, navigation, direction, tool, map, guide, orientation, devtools, workflow, web dev, ui icon, sidebar, menu, button, tooling, design system, reference, utility icon, framework, coding, layout, grid - Devicons - DiCompass - SVG | WEBP | PNG | JPG - Icon free download
DiCompass
css tricks, frontend, css blog, web design, tutorials, learning, design system, frontend dev, styling, ui design, web tips, reference, guide, resources, developer blog, web tools, css writing, layout, flexbox, grid - Devicons - DiCssTricks - SVG | WEBP | PNG | JPG - Icon free download
DiCssTricks
css3, css, styling, frontend, stylesheet, design, layout, web dev, animation, responsive design, ui, html css, browser styling, frameworks, web components, grid, flexbox, theme, appearance, presentation - Devicons - DiCss3Full - SVG | WEBP | PNG | JPG - Icon free download
DiCss3Full
css3, css, frontend, stylesheet, design, layout, web dev, ui, theme, browser styling, grid, flexbox, animation, responsive, presentation, style sheet, web components, developer tools, html css - Devicons - DiCss3 - SVG | WEBP | PNG | JPG - Icon free download
DiCss3
dreamweaver, adobe dreamweaver, editor, web editor, html, css, frontend, design, web design, site builder, templates, layout, developer tools, adobe, creative cloud, wysiwyg, file management, publishing, brand - Devicons - DiDreamweaver - SVG | WEBP | PNG | JPG - Icon free download
DiDreamweaver
dropbox, cloud storage, file sync, file sharing, backup, collaboration, team folders, documents, cloud, storage service, drive, upload, download, workspace, productivity, remote work, sharing platform, security, brand - Devicons - DiDropbox - SVG | WEBP | PNG | JPG - Icon free download
DiDropbox
eclipse, eclipse ide, java ide, developer tools, code editor, ide, programming, workspace, open source, dev environment, plugins, debug, refactor, compiler, productivity tool, software, java development, coding tool - Devicons - DiEclipse - SVG | WEBP | PNG | JPG - Icon free download
DiEclipse
google drive, drive, cloud storage, file storage, documents, sheets, slides, collaboration, sharing, backup, sync, workspace, folders, upload, download, file manager, brand, cloud, productivity, team, organization, web app, office suite - Devicons - DiGoogleDrive - SVG | WEBP | PNG | JPG - Icon free download
DiGoogleDrive
html5, html, frontend, css, javascript, browser, markup, web standard, web design, developer, brand, logo, ui, framework, pwa, modern web, responsive, layout - Devicons - DiHtml5 - SVG | WEBP | PNG | JPG - Icon free download
DiHtml5
intellij, jetbrains, intellij idea, ide, code editor, java ide, developer tool, programming, coding, backend, frontend, workspace, editor, syntax, project, refactor, debug, android, android development, enterprise, build tool, code intelligence, productivity, software, dev environment, developer workflow, devops - Devicons - DiIntellij - SVG | WEBP | PNG | JPG - Icon free download
DiIntellij
materialize, materialize css, css, framework, ui kit, frontend, design system, responsive design, web components, material design, developer, stylesheet, theme, layout, grid, buttons, cards - Devicons - DiMaterializecss - SVG | WEBP | PNG | JPG - Icon free download
DiMaterializecss
netbeans, ide, java ide, editor, developer tools, code editor, open source ide, project management, debugger, compiler, java development, plugins, workspace, coding, productivity, desktop ide - Devicons - DiNetbeans - SVG | WEBP | PNG | JPG - Icon free download
DiNetbeans
raspberry pi, raspberry, pi board, single board computer, sbc, iot, embedded system, maker, electronics, hardware, robotics, arduino alternative, linux board, edge computing, tinkering, prototyping, gpio, microcontroller, education kit, stem, project board, home automation, sensors, device control, python projects - Devicons - DiRasberryPi - SVG | WEBP | PNG | JPG - Icon free download
DiRasberryPi
safari, safari browser, apple browser, web browser, macos, ios, explorer, navigation, internet, web app, ui, ux, mobile, desktop, cross platform, web navigation, browser icon, bookmark, tab, brand - Devicons - DiSafari - SVG | WEBP | PNG | JPG - Icon free download
DiSafari
visual studio, vs, microsoft, ide, editor, code editor, dev, developer tool, programming, csharp, dotnet, debug, compile, workspace, project, software, desktop app, coding tool, header icon, sidebar icon - Devicons - DiVisualstudio - SVG | WEBP | PNG | JPG - Icon free download
DiVisualstudio
windows, microsoft, os, desktop os, win10, win11, pc, system ui, computer, platform, exe, installer, start menu, device, environment, enterprise, software platform, system setting - Devicons - DiWindows - SVG | WEBP | PNG | JPG - Icon free download
DiWindows
android, google android, robot, os, mobile, smartphone, app, apk, development, android developer, play store, material, logo, brand, platform, device, software, tech, ui, widget, navbar, footer, badge - Font Awesome 5 - FaAndroid - SVG | WEBP | PNG | JPG - Icon free download
FaAndroid
app store ios, apple, ios, download, install, mobile app, iphone, ipad, store badge, application, apple store, device, software, brand, logo, cta, button, header, landing page - Font Awesome 5 - FaAppStoreIos - SVG | WEBP | PNG | JPG - Icon free download
FaAppStoreIos
apple, brand, logo, mac, macbook, iphone, ipad, ios, macos, tech company, technology, electronics, hardware, software, branding, mobile, desktop, store, ecosystem, iconic logo, button, badge - Font Awesome 5 - FaApple - SVG | WEBP | PNG | JPG - Icon free download
FaApple
blackberry, brand, mobile, phone, device, enterprise, security, messaging, bbm, smartphone, corporate, platform, logo, badge, communication, email, business phone, legacy device, tech - Font Awesome 5 - FaBlackberry - SVG | WEBP | PNG | JPG - Icon free download
FaBlackberry
Tags
layoutuidevicehardwarepaneleditortoolbargriddesignoutlinescreeniosdisplayandroidbuttonmobiledashboardsidebaralignnavigationmonitorwebsettingspresentationtechfilledwindowworkspacemediaframecomputerdocumentstructurestoragedesktopfileresponsivemenubordertexttemplatepcelectronicscontentformattingconnectordatapositionsystemformatbrandcablevideoofficeleftcontainerresizerightalignmentcssphoneusbtableverticalarrowdirectionexpandtogglepointerportnetworksmartphonehorizontalboxbrightnessarrangecolumnsfrontendindicatorweb designdriveinputchargingpowerinterfaceadjusthddsignallightshapebadgelandscapeiotslidescenterboardchiptilescursortypographydiskcallplugarrowsworkflowpptviewaudiocommunicationcreativeserverbackupwritingmoveui-controllogoperipheralworkstationshrinkmatrixenergyinternettoolbootstrapuxdesign toolui controldeckmemoryadminsuncodingmousetvsoftwareheadereaselconnectivitymeetingdownloadlaptopcollapsegamingstackgeometrystatusartconnectionproductivityiconparagraphcontrastweb appcontroltablettopcamerasectionstechnologydockperformanceplayerpolygonentertainmentiolisthoverresolutionorganizationmodulesui layout