CRUDIOS
stories, story, media, social story, highlight, timeline, content, reels, shorts, status update, photo story, video story, feed, carousel, social ui, css gg - css.gg Icons - CgStories - SVG | WEBP | PNG | JPG - Icon free download
cg/CgStories

cg/CgStories (css.gg Icons)

VS Code
1import { CgStories } from "react-icons/cg";
2
3export default function Page(){
4  return <div><CgStories/></div>
5}
Click To Copy (Free To Use)
Description
Compact stories icon referencing social media story formats for photo, video, or highlight content, ideal for social interfaces, media feeds, storytelling modules, and interactive engagement-driven layouts.
Tags
storiesstorymediasocial storyhighlighttimelinecontentreelsshortsstatus updatephoto storyvideo storyfeedcarouselsocial uicss gg
Categories
mediasocialcommunicationmultimediacontentstorytellinginterfacenavigation
WEBP Download (256px)Customize & Download (HD)
Related Icons
audio, sound, music, volume, media, speaker, track - Ant Design Icons - AiFillAudio - SVG | WEBP | PNG | JPG - Icon free download
AiFillAudio
backward, rewind, previous, media, control, playback - Ant Design Icons - AiFillBackward - SVG | WEBP | PNG | JPG - Icon free download
AiFillBackward
calendar, date, schedule, event, planner, timeline - Ant Design Icons - AiFillCalendar - SVG | WEBP | PNG | JPG - Icon free download
AiFillCalendar
camera, photo, picture, capture, record, media - Ant Design Icons - AiFillCamera - SVG | WEBP | PNG | JPG - Icon free download
AiFillCamera
facebook, social, brand, network, share, media - Ant Design Icons - AiFillFacebook - SVG | WEBP | PNG | JPG - Icon free download
AiFillFacebook
fast-backward, rewind, previous, media, player, control - Ant Design Icons - AiFillFastBackward - SVG | WEBP | PNG | JPG - Icon free download
AiFillFastBackward
fast-forward, skip, next, media, player, control - Ant Design Icons - AiFillFastForward - SVG | WEBP | PNG | JPG - Icon free download
AiFillFastForward
file, image, photo, picture, media, jpg - Ant Design Icons - AiFillFileImage - SVG | WEBP | PNG | JPG - Icon free download
AiFillFileImage
highlight, marker, emphasize, annotation, text, selection - Ant Design Icons - AiFillHighlight - SVG | WEBP | PNG | JPG - Icon free download
AiFillHighlight
instagram, social, photo, media, social-network, brand - Ant Design Icons - AiFillInstagram - SVG | WEBP | PNG | JPG - Icon free download
AiFillInstagram
pause, media, control, player, circle, stop - Ant Design Icons - AiFillPauseCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillPauseCircle
picture, image, photo, gallery, media, landscape - Ant Design Icons - AiFillPicture - SVG | WEBP | PNG | JPG - Icon free download
AiFillPicture
play, media, start, video, audio, player - Ant Design Icons - AiFillPlayCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillPlayCircle
play, media, start, video, audio, player, square - Ant Design Icons - AiFillPlaySquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillPlaySquare
star, favorite, rate, rating, bookmark, mark, highlight - Ant Design Icons - AiFillStar - SVG | WEBP | PNG | JPG - Icon free download
AiFillStar
step, backward, previous, media, control, rewind, button - Ant Design Icons - AiFillStepBackward - SVG | WEBP | PNG | JPG - Icon free download
AiFillStepBackward
step, forward, next, media, control, skip, button - Ant Design Icons - AiFillStepForward - SVG | WEBP | PNG | JPG - Icon free download
AiFillStepForward
stop, halt, media, block, square, end, control - Ant Design Icons - AiFillStop - SVG | WEBP | PNG | JPG - Icon free download
AiFillStop
video, camera, record, film, media, shoot - Ant Design Icons - AiFillVideoCamera - SVG | WEBP | PNG | JPG - Icon free download
AiFillVideoCamera
youtube, video, play, logo, brand, media - Ant Design Icons - AiFillYoutube - SVG | WEBP | PNG | JPG - Icon free download
AiFillYoutube
backward, rewind, media, previous, reverse, playback - Ant Design Icons - AiOutlineBackward - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBackward
camera, photo, capture, image, media, shoot, record - Ant Design Icons - AiOutlineCamera - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCamera
fast, backward, rewind, previous, media, controls - Ant Design Icons - AiOutlineFastBackward - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFastBackward
fast, forward, skip, next, media, controls - Ant Design Icons - AiOutlineFastForward - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFastForward
file, gif, image, animation, media, document, picture - Ant Design Icons - AiOutlineFileGif - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFileGif
file, image, photo, picture, media, document, jpg - Ant Design Icons - AiOutlineFileImage - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFileImage
file, jpg, image, photo, picture, media, document - Ant Design Icons - AiOutlineFileJpg - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFileJpg
file, text, document, note, report, paper, content - Ant Design Icons - AiOutlineFileText - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFileText
file, document, page, blank, paper, content, note - Ant Design Icons - AiOutlineFile - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFile
flag, marker, milestone, country, highlight, bookmark - Ant Design Icons - AiOutlineFlag - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFlag
gif, animation, image, file, media, loop, format - Ant Design Icons - AiOutlineGif - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineGif
highlight, marker, edit, text, emphasize, tool, note - Ant Design Icons - AiOutlineHighlight - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineHighlight
history, recent, clock, past, log, timeline, records - Ant Design Icons - AiOutlineHistory - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineHistory
instagram, social, photo, media, brand, share, camera - Ant Design Icons - AiOutlineInstagram - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineInstagram
medium, logo, brand, blog, writing, content, publish - Ant Design Icons - AiOutlineMedium - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMedium
pause, pause-circle, media, player, control, stop, button - Ant Design Icons - AiOutlinePauseCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePauseCircle
pause, media, control, player, stop, button - Ant Design Icons - AiOutlinePause - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePause
picture, center, align, image, layout, media, photo - Ant Design Icons - AiOutlinePicCenter - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePicCenter
picture, left, align, image, layout, media, photo - Ant Design Icons - AiOutlinePicLeft - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePicLeft
picture, right, align, image, layout, media, photo - Ant Design Icons - AiOutlinePicRight - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePicRight
picture, image, photo, gallery, media, file, thumbnail - Ant Design Icons - AiOutlinePicture - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePicture
pinterest, social, brand, pin, share, network, media - Ant Design Icons - AiOutlinePinterest - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePinterest
play, circle, media, video, start, button, player - Ant Design Icons - AiOutlinePlayCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePlayCircle
play, square, media, video, start, button, player - Ant Design Icons - AiOutlinePlaySquare - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePlaySquare
select, choose, option, picker, cursor, highlight, field - Ant Design Icons - AiOutlineSelect - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSelect
star, favorite, rating, highlight, mark, bookmark - Ant Design Icons - AiOutlineStar - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineStar
step, backward, previous, media, control, rewind - Ant Design Icons - AiOutlineStepBackward - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineStepBackward
step, forward, next, media, control, advance - Ant Design Icons - AiOutlineStepForward - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineStepForward
stop, halt, media, control, end, square - Ant Design Icons - AiOutlineStop - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineStop
camera, photo, picture, image, media, capture, device, photography - Ant Design Icons - AiTwotoneCamera - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCamera
file, image, photo, picture, media, jpg, png - Ant Design Icons - AiTwotoneFileImage - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneFileImage
file, text, document, txt, content, note, read - Ant Design Icons - AiTwotoneFileText - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneFileText
file, document, generic, sheet, page, data, content - Ant Design Icons - AiTwotoneFile - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneFile
highlight, marker, edit, emphasize, tool, note - Ant Design Icons - AiTwotoneHighlight - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneHighlight
pause, circle, media, control, stop, player, multimedia - Ant Design Icons - AiTwotonePauseCircle - SVG | WEBP | PNG | JPG - Icon free download
AiTwotonePauseCircle
picture, image, photo, gallery, media, snapshot, preview - Ant Design Icons - AiTwotonePicture - SVG | WEBP | PNG | JPG - Icon free download
AiTwotonePicture
play, circle, media, start, player, video, multimedia - Ant Design Icons - AiTwotonePlayCircle - SVG | WEBP | PNG | JPG - Icon free download
AiTwotonePlayCircle
play, square, media, start, player, video, control - Ant Design Icons - AiTwotonePlaySquare - SVG | WEBP | PNG | JPG - Icon free download
AiTwotonePlaySquare
star, favorite, rate, rating, bookmark, highlight - Ant Design Icons - AiTwotoneStar - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneStar
video, camera, movie, record, filming, media, stream - Ant Design Icons - AiTwotoneVideoCamera - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneVideoCamera
add, queue, playlist, media, plus, list, order - BoxIcons - BiAddToQueue - SVG | WEBP | PNG | JPG - Icon free download
BiAddToQueue
album, music, record, cover, media, collection - BoxIcons - BiAlbum - SVG | WEBP | PNG | JPG - Icon free download
BiAlbum
book, content, pages, document, library, read, study - BoxIcons - BiBookContent - SVG | WEBP | PNG | JPG - Icon free download
BiBookContent
calendar, star, special, date, highlight, event, important - BoxIcons - BiCalendarStar - SVG | WEBP | PNG | JPG - Icon free download
BiCalendarStar
camera, movie, film, video, record, cinema, media - BoxIcons - BiCameraMovie - SVG | WEBP | PNG | JPG - Icon free download
BiCameraMovie
camera, photo, capture, shoot, media, image, record - BoxIcons - BiCamera - SVG | WEBP | PNG | JPG - Icon free download
BiCamera
captions, subtitle, text, closed-caption, media, video - BoxIcons - BiCaptions - SVG | WEBP | PNG | JPG - Icon free download
BiCaptions
carousel, slider, gallery, images, rotation, media - BoxIcons - BiCarousel - SVG | WEBP | PNG | JPG - Icon free download
BiCarousel
copy, alt, duplicate, document, file, clipboard, clone, content - BoxIcons - BiCopyAlt - SVG | WEBP | PNG | JPG - Icon free download
BiCopyAlt
copy, duplicate, document, file, clipboard, content, clone - BoxIcons - BiCopy - SVG | WEBP | PNG | JPG - Icon free download
BiCopy
disc, cd, dvd, media, audio, storage - BoxIcons - BiDisc - SVG | WEBP | PNG | JPG - Icon free download
BiDisc
fast, forward, circle, skip, media, next, playback - BoxIcons - BiFastForwardCircle - SVG | WEBP | PNG | JPG - Icon free download
BiFastForwardCircle
fast, forward, skip, next, media, playback, double-arrow - BoxIcons - BiFastForward - SVG | WEBP | PNG | JPG - Icon free download
BiFastForward
film, movie, video, reel, media, cinema, clip - BoxIcons - BiFilm - SVG | WEBP | PNG | JPG - Icon free download
BiFilm
headphone, audio, music, sound, listen, media, device - BoxIcons - BiHeadphone - SVG | WEBP | PNG | JPG - Icon free download
BiHeadphone
highlight, marker, edit, emphasize, note, tool - BoxIcons - BiHighlight - SVG | WEBP | PNG | JPG - Icon free download
BiHighlight
history, clock, past, recent, timeline, activity - BoxIcons - BiHistory - SVG | WEBP | PNG | JPG - Icon free download
BiHistory
image, add, picture, upload, photo, media - BoxIcons - BiImageAdd - SVG | WEBP | PNG | JPG - Icon free download
BiImageAdd
image, alt, photo, picture, media, gallery - BoxIcons - BiImageAlt - SVG | WEBP | PNG | JPG - Icon free download
BiImageAlt
image, photo, picture, media, gallery, visual - BoxIcons - BiImage - SVG | WEBP | PNG | JPG - Icon free download
BiImage
images, gallery, photos, pictures, media, stack - BoxIcons - BiImages - SVG | WEBP | PNG | JPG - Icon free download
BiImages
memory-card, storage, sd-card, data, device, media - BoxIcons - BiMemoryCard - SVG | WEBP | PNG | JPG - Icon free download
BiMemoryCard
movie, film, play, video, media, player - BoxIcons - BiMoviePlay - SVG | WEBP | PNG | JPG - Icon free download
BiMoviePlay
movie, film, video, cinema, media, clip - BoxIcons - BiMovie - SVG | WEBP | PNG | JPG - Icon free download
BiMovie
news, article, headline, report, feed, paper - BoxIcons - BiNews - SVG | WEBP | PNG | JPG - Icon free download
BiNews
pause, circle, media, control, stop, player, audio, video - BoxIcons - BiPauseCircle - SVG | WEBP | PNG | JPG - Icon free download
BiPauseCircle
pause, media, control, stop, player, audio, video - BoxIcons - BiPause - SVG | WEBP | PNG | JPG - Icon free download
BiPause
photo, album, gallery, images, collection, media - BoxIcons - BiPhotoAlbum - SVG | WEBP | PNG | JPG - Icon free download
BiPhotoAlbum
play, circle, video, start, media, button - BoxIcons - BiPlayCircle - SVG | WEBP | PNG | JPG - Icon free download
BiPlayCircle
play, start, video, media, button, triangle - BoxIcons - BiPlay - SVG | WEBP | PNG | JPG - Icon free download
BiPlay
rewind, back, reverse, media, controls, circle - BoxIcons - BiRewindCircle - SVG | WEBP | PNG | JPG - Icon free download
BiRewindCircle
rewind, back, reverse, media, controls, previous - BoxIcons - BiRewind - SVG | WEBP | PNG | JPG - Icon free download
BiRewind
rss, feed, subscribe, news, broadcast, signal - BoxIcons - BiRss - SVG | WEBP | PNG | JPG - Icon free download
BiRss
selection, select, choose, highlight, picker, form, tool - BoxIcons - BiSelection - SVG | WEBP | PNG | JPG - Icon free download
BiSelection
star, favorite, rating, mark, highlight, bookmark - BoxIcons - BiStar - SVG | WEBP | PNG | JPG - Icon free download
BiStar
stop, stop-circle, halt, media, record, warning, button - BoxIcons - BiStopCircle - SVG | WEBP | PNG | JPG - Icon free download
BiStopCircle
stop, halt, media, warning, button, end - BoxIcons - BiStop - SVG | WEBP | PNG | JPG - Icon free download
BiStop
text, type, input, content, editor, writing, field - BoxIcons - BiText - SVG | WEBP | PNG | JPG - Icon free download
BiText
trim, cut, edit, crop, adjust, media, modify - BoxIcons - BiTrim - SVG | WEBP | PNG | JPG - Icon free download
BiTrim
tv, television, screen, display, monitor, media - BoxIcons - BiTv - SVG | WEBP | PNG | JPG - Icon free download
BiTv
video, plus, add, new, camera, record, create, content - BoxIcons - BiVideoPlus - SVG | WEBP | PNG | JPG - Icon free download
BiVideoPlus
video, camera, film, record, play, media, stream - BoxIcons - BiVideo - SVG | WEBP | PNG | JPG - Icon free download
BiVideo
add, queue, playlist, media, list, plus, task - BoxIcons - BiSolidAddToQueue - SVG | WEBP | PNG | JPG - Icon free download
BiSolidAddToQueue
book, content, index, reading, library, pages, document - BoxIcons - BiSolidBookContent - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBookContent
bookmark, star, favorite, save, highlight, document - BoxIcons - BiSolidBookmarkStar - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBookmarkStar
calendar, star, special, highlight, event, date, important - BoxIcons - BiSolidCalendarStar - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCalendarStar
calendar, week, weekly, planner, schedule, date, timeline - BoxIcons - BiSolidCalendarWeek - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCalendarWeek
camera, photo, video, record, picture, shoot, media - BoxIcons - BiSolidCamera - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCamera
captions, subtitles, text, cc, video, audio, media - BoxIcons - BiSolidCaptions - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCaptions
carousel, slider, gallery, rotate, images, ui, media - BoxIcons - BiSolidCarousel - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCarousel
disc, cd, dvd, media, music, audio - BoxIcons - BiSolidDisc - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDisc
eject, media, remove, drive, cd, player, stop - BoxIcons - BiSolidEject - SVG | WEBP | PNG | JPG - Icon free download
BiSolidEject
fast, forward, skip, circle, media, control - BoxIcons - BiSolidFastForwardCircle - SVG | WEBP | PNG | JPG - Icon free download
BiSolidFastForwardCircle
file, gif, image, animation, media, document - BoxIcons - BiSolidFileGif - SVG | WEBP | PNG | JPG - Icon free download
BiSolidFileGif
file, image, photo, picture, media, document - BoxIcons - BiSolidFileImage - SVG | WEBP | PNG | JPG - Icon free download
BiSolidFileImage
image, add, upload, photo, media, gallery - BoxIcons - BiSolidImageAdd - SVG | WEBP | PNG | JPG - Icon free download
BiSolidImageAdd
image, alt, photo, media, picture, gallery - BoxIcons - BiSolidImageAlt - SVG | WEBP | PNG | JPG - Icon free download
BiSolidImageAlt
image, photo, picture, media, gallery, visual - BoxIcons - BiSolidImage - SVG | WEBP | PNG | JPG - Icon free download
BiSolidImage
movie, play, video, film, media, watch, player, clip - BoxIcons - BiSolidMoviePlay - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMoviePlay
movie, film, cinema, video, media, clip, entertainment - BoxIcons - BiSolidMovie - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMovie
news, article, headline, feed, update, press, report - BoxIcons - BiSolidNews - SVG | WEBP | PNG | JPG - Icon free download
BiSolidNews
photo, album, gallery, images, collection, media, pictures - BoxIcons - BiSolidPhotoAlbum - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPhotoAlbum
playlist, music, list, media, songs, audio, tracks - BoxIcons - BiSolidPlaylist - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPlaylist
rewind, back, reverse, media, circle, control - BoxIcons - BiSolidRewindCircle - SVG | WEBP | PNG | JPG - Icon free download
BiSolidRewindCircle
slideshow, presentation, images, gallery, display, media - BoxIcons - BiSolidSlideshow - SVG | WEBP | PNG | JPG - Icon free download
BiSolidSlideshow
star, favorite, rating, review, score, highlight - BoxIcons - BiSolidStar - SVG | WEBP | PNG | JPG - Icon free download
BiSolidStar
tv, television, screen, display, monitor, media - BoxIcons - BiSolidTv - SVG | WEBP | PNG | JPG - Icon free download
BiSolidTv
video, off, disable, camera-off, mute, call, record, media - BoxIcons - BiSolidVideoOff - SVG | WEBP | PNG | JPG - Icon free download
BiSolidVideoOff
video, plus, add, new-video, record, media, camera, create - BoxIcons - BiSolidVideoPlus - SVG | WEBP | PNG | JPG - Icon free download
BiSolidVideoPlus
video, recording, camera, record, media, film, capture, live - BoxIcons - BiSolidVideoRecording - SVG | WEBP | PNG | JPG - Icon free download
BiSolidVideoRecording
video, camera, media, film, record, play, clip, movie - BoxIcons - BiSolidVideo - SVG | WEBP | PNG | JPG - Icon free download
BiSolidVideo
videos, video, clips, media, playlist, library - BoxIcons - BiSolidVideos - SVG | WEBP | PNG | JPG - Icon free download
BiSolidVideos
blogger, blog, write, post, google, brand, content - BoxIcons - BiLogoBlogger - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBlogger
creative, commons, cc, license, rights, brand, media - BoxIcons - BiLogoCreativeCommons - SVG | WEBP | PNG | JPG - Icon free download
BiLogoCreativeCommons
dailymotion, video, media, stream, brand, watch, share - BoxIcons - BiLogoDailymotion - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDailymotion
digg, news, share, feed, social, brand, content - BoxIcons - BiLogoDigg - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDigg
drupal, cms, website, content, developer, brand, platform - BoxIcons - BiLogoDrupal - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDrupal
facebook, circle, social, media, share, profile, logo - BoxIcons - BiLogoFacebookCircle - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFacebookCircle
facebook, square, social, media, share, profile, logo - BoxIcons - BiLogoFacebookSquare - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFacebookSquare
facebook, social, media, share, profile, logo, community - BoxIcons - BiLogoFacebook - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFacebook
google, plus, social, media, share, community, logo - BoxIcons - BiLogoGooglePlus - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGooglePlus
instagram, alt, photo, share, stories, camera, logo - BoxIcons - BiLogoInstagramAlt - SVG | WEBP | PNG | JPG - Icon free download
BiLogoInstagramAlt
instagram, photo, share, social, stories, camera, logo - BoxIcons - BiLogoInstagram - SVG | WEBP | PNG | JPG - Icon free download
BiLogoInstagram
joomla, cms, website, platform, content, builder - BoxIcons - BiLogoJoomla - SVG | WEBP | PNG | JPG - Icon free download
BiLogoJoomla
pinterest, pin, social, share, alt, media - BoxIcons - BiLogoPinterestAlt - SVG | WEBP | PNG | JPG - Icon free download
BiLogoPinterestAlt
pinterest, pin, social, media, share, follow - BoxIcons - BiLogoPinterest - SVG | WEBP | PNG | JPG - Icon free download
BiLogoPinterest
snapchat, snap, story, camera, friends, chat - BoxIcons - BiLogoSnapchat - SVG | WEBP | PNG | JPG - Icon free download
BiLogoSnapchat
tumblr, blog, microblog, social, posts, media, community - BoxIcons - BiLogoTumblr - SVG | WEBP | PNG | JPG - Icon free download
BiLogoTumblr
unsplash, photos, images, stock, gallery, pictures, media - BoxIcons - BiLogoUnsplash - SVG | WEBP | PNG | JPG - Icon free download
BiLogoUnsplash
vimeo, video, host, creator, film, upload, media - BoxIcons - BiLogoVimeo - SVG | WEBP | PNG | JPG - Icon free download
BiLogoVimeo
youtube, video, play, media, brand, streaming - BoxIcons - BiLogoYoutube - SVG | WEBP | PNG | JPG - Icon free download
BiLogoYoutube
3d, badge, quality, media, label, format - Bootstrap Icons - BsFillBadge3dFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadge3dFill
4k, badge, ultra hd, media, quality, format - Bootstrap Icons - BsFillBadge4kFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadge4kFill
8k, badge, ultra hd, media, quality, format - Bootstrap Icons - BsFillBadge8kFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadge8kFill
ad, advertisement, badge, media, label, promo - Bootstrap Icons - BsFillBadgeAdFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeAdFill
ar, augmented reality, badge, media, tech, label - Bootstrap Icons - BsFillBadgeArFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeArFill
cc, closed captions, badge, subtitles, media, accessibility - Bootstrap Icons - BsFillBadgeCcFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeCcFill
hd, high definition, badge, media, quality, format - Bootstrap Icons - BsFillBadgeHdFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeHdFill
sd, standard definition, badge, media, quality, format - Bootstrap Icons - BsFillBadgeSdFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeSdFill
vo, voiceover, badge, audio, label, media - Bootstrap Icons - BsFillBadgeVoFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeVoFill
vr, virtual reality, badge, media, tech, label - Bootstrap Icons - BsFillBadgeVrFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeVrFill
bookmark, star, favorite, highlight, save, mark - Bootstrap Icons - BsFillBookmarkStarFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBookmarkStarFill
camera, photo, shoot, capture, image, media, picture - Bootstrap Icons - BsFillCameraFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCameraFill
camera, reels, film, movie, video, record, media - Bootstrap Icons - BsFillCameraReelsFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCameraReelsFill
camera, video, record, movie, film, capture, media - Bootstrap Icons - BsFillCameraVideoFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCameraVideoFill
camera, video, off, disable, mute, recording, media - Bootstrap Icons - BsFillCameraVideoOffFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCameraVideoOffFill
cassette, tape, audio, music, retro, record, media - Bootstrap Icons - BsFillCassetteFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCassetteFill
cc, closed-caption, circle, subtitles, video, caption, media - Bootstrap Icons - BsFillCcCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCcCircleFill
cc, closed-caption, square, subtitles, video, caption, media - Bootstrap Icons - BsFillCcSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCcSquareFill
collection, library, albums, folder, media, list - Bootstrap Icons - BsFillCollectionFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCollectionFill
collection, play, playlist, media, video, library - Bootstrap Icons - BsFillCollectionPlayFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCollectionPlayFill
disc, cd, dvd, music, media, audio - Bootstrap Icons - BsFillDiscFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDiscFill
eject, media, player, remove, disc, control - Bootstrap Icons - BsFillEjectFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillEjectFill
explicit, label, content, restriction, adult, warning - Bootstrap Icons - BsFillExplicitFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillExplicitFill
fast, forward, skip, next, media, control - Bootstrap Icons - BsFillFastForwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFastForwardFill
file, image, photo, picture, media, document, jpeg - Bootstrap Icons - BsFillFileEarmarkImageFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkImageFill
file, music, audio, song, media, mp3, document - Bootstrap Icons - BsFillFileEarmarkMusicFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkMusicFill
file, play, video, media, movie, document, clip - Bootstrap Icons - BsFillFileEarmarkPlayFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkPlayFill
file, text, document, note, write, txt, content - Bootstrap Icons - BsFillFileEarmarkTextFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileEarmarkTextFill
file, image, photo, picture, media, document - Bootstrap Icons - BsFillFileImageFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileImageFill
file, play, video, media, clip, document - Bootstrap Icons - BsFillFilePlayFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFilePlayFill
image, photo, picture, media, gallery, file - Bootstrap Icons - BsFillImageFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillImageFill
music, player, audio, mp3, media, sound, playback - Bootstrap Icons - BsFillMusicPlayerFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMusicPlayerFill
optical, audio, toslink, sound, cable, digital, media - Bootstrap Icons - BsFillOpticalAudioFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillOpticalAudioFill
pause, button, media, control, stop, player, ui - Bootstrap Icons - BsFillPauseBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPauseBtnFill
pause, circle, media, control, stop, player, ui - Bootstrap Icons - BsFillPauseCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPauseCircleFill
pause, media, stop, control, player, button, ui - Bootstrap Icons - BsFillPauseFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPauseFill
play, button, media, video, audio, start, play-btn - Bootstrap Icons - BsFillPlayBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPlayBtnFill
play, circle, video, audio, start, media, play-circle - Bootstrap Icons - BsFillPlayCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPlayCircleFill
play, start, video, audio, media, triangle, playback - Bootstrap Icons - BsFillPlayFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPlayFill
record, btn, record-btn, media, audio, video, mic, capture, rec, start-record, button, control, ui, live, stream, round-button - Bootstrap Icons - BsFillRecordBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRecordBtnFill
record, circle, record-circle, media, audio, video, capture, rec, live, stream, mic, button, ui-control, media-button - Bootstrap Icons - BsFillRecordCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRecordCircleFill
record, rec, media, audio, video, capture, live, stream, mic, dot, indicator, ui, button, media-control - Bootstrap Icons - BsFillRecordFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRecordFill
record, record2, rec, media, audio, video, capture, indicator, live, stream, mic, ui, button - Bootstrap Icons - BsFillRecord2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRecord2Fill
rewind, btn, rewind-btn, media, audio, video, back, previous, reverse, player, control, ui-button, seek - Bootstrap Icons - BsFillRewindBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRewindBtnFill
rewind, circle, rewind-circle, media, audio, video, back, rewind-control, reverse, previous, ui, button - Bootstrap Icons - BsFillRewindCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRewindCircleFill
rewind, media, audio, video, reverse, previous, seek, back, playback, ui-control - Bootstrap Icons - BsFillRewindFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRewindFill
rss, feed, news, subscription, blog, broadcast, signal, updates, syndication, reader, web-feed, follow - Bootstrap Icons - BsFillRssFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRssFill
sd, sd-card, memory-card, storage, flash, device, hardware, media, camera-card, portable-storage, data, transfer, backup - Bootstrap Icons - BsFillSdCardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSdCardFill
skip, backward, skip-backward, media, media-control, player, rewind, previous, audio, video, track, button, btn, playback, navigation, toolbar, music, movie, media-player, control-button, seek-back - Bootstrap Icons - BsFillSkipBackwardBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipBackwardBtnFill
skip, backward, skip-backward, circle, round, media, rewind, previous, track, audio, video, player, playback, control, media-button, toolbar, music, navigation, seek-back - Bootstrap Icons - BsFillSkipBackwardCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipBackwardCircleFill
skip, backward, skip-backward, rewind, previous, track, audio, video, player, media, playback, control, media-button, toolbar, navigation, seek-back - Bootstrap Icons - BsFillSkipBackwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipBackwardFill
skip, end, skip-end, next, forward, media, track-end, audio, video, player, button, btn, media-control, toolbar, navigation, seek-forward, playback - Bootstrap Icons - BsFillSkipEndBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipEndBtnFill
skip, end, skip-end, circle, round, media, next, forward, track-end, player, audio, video, media-button, toolbar, playback, seek-forward - Bootstrap Icons - BsFillSkipEndCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipEndCircleFill
skip, end, skip-end, next, forward, media, audio, video, player, track-end, playback, control, toolbar, navigation, seek-forward - Bootstrap Icons - BsFillSkipEndFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipEndFill
skip, forward, skip-forward, next, media, btn, button, audio, video, player, track, media-control, playback, navigation, seek-forward - Bootstrap Icons - BsFillSkipForwardBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipForwardBtnFill
skip, forward, skip-forward, circle, round, next, media, audio, video, player, control, playback, toolbar, navigation, seek-forward - Bootstrap Icons - BsFillSkipForwardCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipForwardCircleFill
skip, forward, skip-forward, next, media, audio, video, player, playback, control, navigation, seek-forward, toolbar - Bootstrap Icons - BsFillSkipForwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipForwardFill
skip, start, skip-start, rewind, beginning, btn, button, media, audio, video, track-start, player, control, playback, navigation - Bootstrap Icons - BsFillSkipStartBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipStartBtnFill
skip, start, skip-start, circle, round, rewind, beginning, media, audio, video, player, control, playback, seek-start - Bootstrap Icons - BsFillSkipStartCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipStartCircleFill
skip, start, skip-start, rewind, beginning, media, audio, video, player, control, playback, seek-start - Bootstrap Icons - BsFillSkipStartFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipStartFill
speaker, audio, sound, volume, loud, media, output, device, music, voice, alert, announcement, notification, speaker-icon, sound-output, media-control - Bootstrap Icons - BsFillSpeakerFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSpeakerFill
star, fill, filled, rating, favorite, bookmark, like, highlight, featured, award, review, rating-star, favorite-button, badge, icon-button, navigation, toolbar, badge-count, ui-element, svg, rating-widget, customer-review, top-pick, highlighted - Bootstrap Icons - BsFillStarFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStarFill
tablet, landscape, device, horizontal, screen, touchscreen, electronics, responsive, orientation, media, ipad, android-tablet, layout, interface - Bootstrap Icons - BsFillTabletLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTabletLandscapeFill
tv, television, screen, monitor, display, media, video, entertainment, electronics, device, smart-tv, home, ui - Bootstrap Icons - BsFillTvFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTvFill
vinyl, record, vinyl-record, music, audio, disc, lp, retro, analog, sound, turntable, album, media, entertainment, playlist, collection, player, music-library, audio-file, classic, archives, toolbar, dashboard - Bootstrap Icons - BsFillVinylFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillVinylFill
reverse, layout, text, sidebar, text-sidebar, reverse-layout, panel, columns, ui, interface, typography-layout, content, template, web-layout, design, builder - Bootstrap Icons - BsReverseLayoutTextSidebarReverse - SVG | WEBP | PNG | JPG - Icon free download
BsReverseLayoutTextSidebarReverse
4, number-4, square, shape, box, outline-square, digit, symbol, ui, grid, button, badge, marker, tile, highlight, selection, placeholder, bootstrap, ios, android - Bootstrap Icons - Bs4Square - SVG | WEBP | PNG | JPG - Icon free download
Bs4Square
align, bottom, align-bottom, layout, editor, toolbar, design, format, positioning, ui, content - Bootstrap Icons - BsAlignBottom - SVG | WEBP | PNG | JPG - Icon free download
BsAlignBottom
align, center, align-center, layout, editor, toolbar, format, design, positioning, ui, content - Bootstrap Icons - BsAlignCenter - SVG | WEBP | PNG | JPG - Icon free download
BsAlignCenter
arrow, repeat, loop, redo, refresh, cycle, reload, retry, replay, ui, action, media, sync, rotate - Bootstrap Icons - BsArrowRepeat - SVG | WEBP | PNG | JPG - Icon free download
BsArrowRepeat
badge, 3d, three-dimensional, filled, video, media, sticker, label, tag, display, resolution, quality, banner, promo, card - Bootstrap Icons - BsBadge3dFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadge3dFill
badge, 3d, three-dimensional, outline, media, video, label, tag, sticker, resolution, quality, display, promo - Bootstrap Icons - BsBadge3D - SVG | WEBP | PNG | JPG - Icon free download
BsBadge3D
badge, 4k, ultra-hd, uhd, video, resolution, quality, media, display, label, sticker, promo, filled - Bootstrap Icons - BsBadge4kFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadge4kFill
badge, 4k, ultra-hd, uhd, resolution, video, media, display, tag, label, sticker, quality, outline - Bootstrap Icons - BsBadge4K - SVG | WEBP | PNG | JPG - Icon free download
BsBadge4K
badge, 8k, ultra-hd, uhd, super-high-resolution, video, media, display, quality, label, sticker, promo, filled - Bootstrap Icons - BsBadge8kFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadge8kFill
badge, 8k, ultra-hd, uhd, video, resolution, media, quality, display, sticker, tag, outline - Bootstrap Icons - BsBadge8K - SVG | WEBP | PNG | JPG - Icon free download
BsBadge8K
badge, ad, advertisement, ads, promo, marketing, branding, banner, label, sticker, filled, tag, campaign, highlight - Bootstrap Icons - BsBadgeAdFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeAdFill
badge, ar, audio, recording, augmented, subtitle, language, label, tag, filled, chip, ui, interface, sticker, indicator, media, caption, badge-ar, audio-tag - Bootstrap Icons - BsBadgeArFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeArFill
badge, ar, audio, recording, augmented, subtitle, outline, label, tag, chip, ui, interface, media, caption, indicator, sticker, badge-ar, audio-label - Bootstrap Icons - BsBadgeAr - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeAr
badge, cc, closed-captions, captions, subtitle, filled, label, tag, media, video, audio, accessibility, cc-badge, captioning, interface, sticker, indicator, cc-label - Bootstrap Icons - BsBadgeCcFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeCcFill
badge, cc, closed-captions, captions, subtitle, outline, media, accessibility, video, audio, label, tag, sticker, chip, indicator, player, cc-icon - Bootstrap Icons - BsBadgeCc - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeCc
badge, hd, high-definition, video, quality, filled, label, tag, media, display, resolution, streaming, hd-icon, indicator, player, ui - Bootstrap Icons - BsBadgeHdFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeHdFill
badge, hd, high-definition, outline, video, quality, media, streaming, resolution, display, label, tag, indicator, player, hd-icon - Bootstrap Icons - BsBadgeHd - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeHd
badge, sd, standard-definition, filled, video, quality, media, resolution, display, streaming, label, tag, indicator, player, sd-icon - Bootstrap Icons - BsBadgeSdFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeSdFill
badge, sd, standard-definition, outline, video, quality, media, streaming, resolution, display, label, tag, indicator, player, sd-label - Bootstrap Icons - BsBadgeSd - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeSd
badge, vo, voice-over, filled, audio, video, subtitle, caption, label, tag, media, interface, indicator, vo-tag, voice, recording - Bootstrap Icons - BsBadgeVoFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeVoFill
badge, vo, voice-over, outline, audio, video, subtitle, caption, media, label, tag, indicator, vo-icon, voice, record - Bootstrap Icons - BsBadgeVo - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeVo
badge, vr, virtual-reality, filled, gaming, technology, media, immersive, label, tag, interface, vr-icon, headset, 3d, indicator - Bootstrap Icons - BsBadgeVrFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeVrFill
badge, vr, virtual-reality, outline, gaming, immersive, technology, media, label, tag, vr-icon, interface, 3d, indicator, vr-badge - Bootstrap Icons - BsBadgeVr - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeVr
blockquote, left, quote, text, editor, typography, comment, message, blog, markdown, writing, formatting, ui, article, content - Bootstrap Icons - BsBlockquoteLeft - SVG | WEBP | PNG | JPG - Icon free download
BsBlockquoteLeft
blockquote, right, quote, text, editor, typography, comment, message, blog, writing, markdown, formatting, ui, content - Bootstrap Icons - BsBlockquoteRight - SVG | WEBP | PNG | JPG - Icon free download
BsBlockquoteRight
body, text, typography, paragraph, editor, content, writing, formatting, article, blog, markdown, ui, document - Bootstrap Icons - BsBodyText - SVG | WEBP | PNG | JPG - Icon free download
BsBodyText
book, filled, read, library, education, study, learning, knowledge, document, manual, guide, textbook, ui, content - Bootstrap Icons - BsBookFill - SVG | WEBP | PNG | JPG - Icon free download
BsBookFill
book, half, open-book, reading, library, education, study, content, text, manual, knowledge, learning - Bootstrap Icons - BsBookHalf - SVG | WEBP | PNG | JPG - Icon free download
BsBookHalf
book, education, read, library, study, text, manual, knowledge, learning, content, document, ui - Bootstrap Icons - BsBook - SVG | WEBP | PNG | JPG - Icon free download
BsBook
bookmark, star, bookmark-star, favorite, save, saved, highlight, reading-list, collection, marker, pin, button, toggle, active, hover, badge, header, sidebar, card, bootstrap, react-icons, filled, ui-icon, mobile, web - Bootstrap Icons - BsBookmarkStarFill - SVG | WEBP | PNG | JPG - Icon free download
BsBookmarkStarFill
bookshelf, shelf, library, books, collection, reading, archive, catalog, media, education, knowledge, outline, menu, library-page, dashboard, card, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBookshelf - SVG | WEBP | PNG | JPG - Icon free download
BsBookshelf
broadcast, signal, radio, wifi, antenna, transmission, connectivity, live, stream, media, network, wave - Bootstrap Icons - BsBroadcast - SVG | WEBP | PNG | JPG - Icon free download
BsBroadcast
calendar, event, calendar-event, schedule, appointment, meeting, planner, date, reminder, timeline, agenda, work, task, booking, ui, header, toolbar, icon, outline, month-view, day-view - Bootstrap Icons - BsCalendarEvent - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarEvent
calendar, range, calendar-range, date-range, filled, period, timeline, schedule, planner, booking, range-picker - Bootstrap Icons - BsCalendarRangeFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarRangeFill
calendar, range, calendar-range, period, date-range, line, schedule, planner, ui, timeline - Bootstrap Icons - BsCalendarRange - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarRange
calendar, week, calendar-week, filled, weekly-view, schedule, planner, agenda, ui, date, timeline - Bootstrap Icons - BsCalendarWeekFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarWeekFill
calendar, week, calendar-week, line, weekly, schedule, planner, agenda, date, timeline - Bootstrap Icons - BsCalendarWeek - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarWeek
calendar, date, day, schedule, planner, timeline, event, ui, outline-calendar, appointment - Bootstrap Icons - BsCalendar2Date - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar2Date
calendar, event, outline-calendar, schedule, reminder, planner, appointment, task, timeline - Bootstrap Icons - BsCalendar2Event - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar2Event
calendar, calendar3, event, calendar-event, schedule, date, day, appointment, meeting, planner, timeline, agenda, reminder, booking, ui, ux, toolbar, menu, button, header, footer, nav, ios, android, webapp - Bootstrap Icons - BsCalendar3Event - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3Event
calendar, calendar3, range, date-range, range-fill, filled, duration, period, interval, schedule, timeline, planner, booking, availability, ui, ux, datepicker, range-picker, webapp - Bootstrap Icons - BsCalendar3RangeFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3RangeFill
calendar, calendar3, range, date-range, outline, interval, period, duration, availability, planner, timeline, booking, datepicker, range-picker, ui, ux, toolbar - Bootstrap Icons - BsCalendar3Range - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3Range
calendar, calendar3, week, week-view, filled, weekly, planner, agenda, schedule, timeline, ui, ux, dashboard, toolbar, header, android, ios - Bootstrap Icons - BsCalendar3WeekFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3WeekFill
calendar, calendar3, week, weekly, outline, planner, agenda, schedule, date, timeline, ui, ux, webapp, toolbar, meeting, events - Bootstrap Icons - BsCalendar3Week - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3Week
calendar, calendar4, event, calendar-event, schedule, meeting, appointment, planner, timeline, agenda, booking, ui, ux, toolbar, date - Bootstrap Icons - BsCalendar4Event - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar4Event
calendar, calendar4, range, date-range, interval, duration, period, datepicker, range-picker, planner, schedule, booking, ui, ux, timeline - Bootstrap Icons - BsCalendar4Range - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar4Range
calendar, calendar4, week, weekly, weekly-view, planner, agenda, schedule, timeline, ui, ux, toolbar, date, meeting - Bootstrap Icons - BsCalendar4Week - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar4Week
calendar, calendar4, date, day, month, year, schedule, event, planner, agenda, booking, appointments, timeline, reminder, ui, navbar, toolbar, button, sidebar, productivity, office - Bootstrap Icons - BsCalendar4 - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar4
camera, camera-fill, photo, photography, capture, shoot, picture, image, media, gallery, content, record, focus, lens, snapshot, upload, ui, mobile, toolbar, button - Bootstrap Icons - BsCameraFill - SVG | WEBP | PNG | JPG - Icon free download
BsCameraFill
camera, reels, camera-reels, camera-reels-fill, video, film, movie, cinema, footage, recording, media, clip, roll, editor, production, entertainment, content, ui, toolbar - Bootstrap Icons - BsCameraReelsFill - SVG | WEBP | PNG | JPG - Icon free download
BsCameraReelsFill
camera, reels, camera-reels, video, film, movie, cinema, record, footage, media, editing, production, clip, ui, button, toolbar - Bootstrap Icons - BsCameraReels - SVG | WEBP | PNG | JPG - Icon free download
BsCameraReels
camera, video, camera-video-fill, record, film, clip, media, shoot, stream, livestream, broadcast, camera-record, webcam, videocall, capture, ui, button - Bootstrap Icons - BsCameraVideoFill - SVG | WEBP | PNG | JPG - Icon free download
BsCameraVideoFill
camera, video, camera-video, record, film, clip, media, shoot, stream, live, capture, broadcast, webcam, call, button, ui - Bootstrap Icons - BsCameraVideo - SVG | WEBP | PNG | JPG - Icon free download
BsCameraVideo
camera, photo, photography, capture, shoot, image, picture, media, gallery, focus, lens, snapshot, upload, ui, toolbar, button - Bootstrap Icons - BsCamera - SVG | WEBP | PNG | JPG - Icon free download
BsCamera
camera, camera2, photo, photography, image, capture, shoot, lens, snapshot, media, gallery, focus, ui, button, toolbar - Bootstrap Icons - BsCamera2 - SVG | WEBP | PNG | JPG - Icon free download
BsCamera2
card, image, photo, picture, thumbnail, media, preview, gallery, ui-card, visual-content - Bootstrap Icons - BsCardImage - SVG | WEBP | PNG | JPG - Icon free download
BsCardImage
card, text, paragraph, content, ui-card, description, label, copy, section - Bootstrap Icons - BsCardText - SVG | WEBP | PNG | JPG - Icon free download
BsCardText
caret, left, arrow, back, previous, navigate-left, slide, carousel, filled, ui-control - Bootstrap Icons - BsCaretLeftFill - SVG | WEBP | PNG | JPG - Icon free download
BsCaretLeftFill
caret, right, arrow, next, forward, navigate-right, slide, carousel, filled, ui-control - Bootstrap Icons - BsCaretRightFill - SVG | WEBP | PNG | JPG - Icon free download
BsCaretRightFill
caret, right, arrow, caret-right, next, forward, navigate, direction, pointer, triangle, chevron, ui, button, sidebar, menu, list, carousel, tab - Bootstrap Icons - BsCaretRight - SVG | WEBP | PNG | JPG - Icon free download
BsCaretRight
cassette, cassette-fill, tape, audio, music, retro, vintage, recording, media, playlist, sound, old-school, album, mixtape, player, multimedia, ui - Bootstrap Icons - BsCassetteFill - SVG | WEBP | PNG | JPG - Icon free download
BsCassetteFill
cassette, tape, audio, music, retro, vintage, recording, media, playlist, sound, mixtape, old-school, player, album, multimedia, ui - Bootstrap Icons - BsCassette - SVG | WEBP | PNG | JPG - Icon free download
BsCassette
cc, closed-caption, circle, cc-circle, caption, subtitle, accessibility, video, media, multimedia, hearing, assist, streaming, player, ui, control - Bootstrap Icons - BsCcCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsCcCircleFill
cc, closed-caption, circle, cc-circle, caption, subtitle, accessibility, hearing, media, video, player, streaming, control, assist - Bootstrap Icons - BsCcCircle - SVG | WEBP | PNG | JPG - Icon free download
BsCcCircle
chevron, double, left, double-left, arrow, navigate, previous, back, direction, ui, carousel, pagination, slider, sidebar, ios, android, web - Bootstrap Icons - BsChevronDoubleLeft - SVG | WEBP | PNG | JPG - Icon free download
BsChevronDoubleLeft
chevron, double, right, double-right, navigate, arrow, next, forward, carousel, slider, pagination, ui, web, android, ios - Bootstrap Icons - BsChevronDoubleRight - SVG | WEBP | PNG | JPG - Icon free download
BsChevronDoubleRight
chevron, left, arrow, navigate, previous, back, direction, ui, carousel, slider, pagination, ios, android, web - Bootstrap Icons - BsChevronLeft - SVG | WEBP | PNG | JPG - Icon free download
BsChevronLeft
chevron, right, arrow, navigate, next, forward, direction, ui, carousel, slider, pagination, android, ios, web - Bootstrap Icons - BsChevronRight - SVG | WEBP | PNG | JPG - Icon free download
BsChevronRight
clock, history, time, recent, past, timeline, log, records, tracking, event, restore, previous, clock-history, ui, dashboard - Bootstrap Icons - BsClockHistory - SVG | WEBP | PNG | JPG - Icon free download
BsClockHistory
collection, library, folder, media, group, items, files, list, gallery, archive, playlist, ui, content, dashboard - Bootstrap Icons - BsCollectionFill - SVG | WEBP | PNG | JPG - Icon free download
BsCollectionFill
collection-play, library, playlist, media, play, video, audio, stream, entertainment, folder, gallery, ui, controls - Bootstrap Icons - BsCollectionPlayFill - SVG | WEBP | PNG | JPG - Icon free download
BsCollectionPlayFill
collection-play, play, media, playlist, library, video, audio, stream, folder, controls, ui - Bootstrap Icons - BsCollectionPlay - SVG | WEBP | PNG | JPG - Icon free download
BsCollectionPlay
collection, library, folder, archive, items, list, group, content, gallery, media, dashboard - Bootstrap Icons - BsCollection - SVG | WEBP | PNG | JPG - Icon free download
BsCollection
crop, resize, edit, image-edit, trim, cut, photo, design, ui, toolbar, editor, media, adjust, selection - Bootstrap Icons - BsCrop - SVG | WEBP | PNG | JPG - Icon free download
BsCrop
disc, cd, dvd, media, music, audio, song, album, record, playlist, music-player, sound, storage, optical-disc, filled, ui, button, multimedia, ios, android, web - Bootstrap Icons - BsDiscFill - SVG | WEBP | PNG | JPG - Icon free download
BsDiscFill
disc, cd, dvd, optical-disc, media, audio, music, album, record, playlist, outline, sound, storage, ui, button, multimedia, minimal, web, ios, android - Bootstrap Icons - BsDisc - SVG | WEBP | PNG | JPG - Icon free download
BsDisc
dot, point, bullet, indicator, status, marker, minimal, tiny, ui, list, item, separator, symbol, badge, highlight, cursor, android, ios, web - Bootstrap Icons - BsDot - SVG | WEBP | PNG | JPG - Icon free download
BsDot
earbuds, earphones, headphones, audio, music, sound, listen, media, device, portable-audio, wireless, wired, stereo, entertainment - Bootstrap Icons - BsEarbuds - SVG | WEBP | PNG | JPG - Icon free download
BsEarbuds
eject, eject-fill, media, control, player, audio, video, dvd, cd, remove, unmount, hardware, device, button, toolbar, ui, ios, android, web, playback, action, triangle, upward, system-control - Bootstrap Icons - BsEjectFill - SVG | WEBP | PNG | JPG - Icon free download
BsEjectFill
eject, media, control, line, outline, player, audio, video, remove, unmount, hardware, button, ui, toolbar, playback, triangle, system-control - Bootstrap Icons - BsEject - SVG | WEBP | PNG | JPG - Icon free download
BsEject
explicit, e, rating, warning, label, adult, content, media, audio, video, song, album, parental-advisory, filled - Bootstrap Icons - BsExplicitFill - SVG | WEBP | PNG | JPG - Icon free download
BsExplicitFill
explicit, e, rating, warning, label, adult, content, media, audio, video, song, album, outline - Bootstrap Icons - BsExplicit - SVG | WEBP | PNG | JPG - Icon free download
BsExplicit
exposure, camera, photo, edit, adjust, brightness, light, contrast, editor, media, image, tool, photography - Bootstrap Icons - BsExposure - SVG | WEBP | PNG | JPG - Icon free download
BsExposure
eyedropper, color-picker, pick, sample, dropper, design, tool, editor, ui, media, paint - Bootstrap Icons - BsEyedropper - SVG | WEBP | PNG | JPG - Icon free download
BsEyedropper
fast-forward, button, media, control, skip, next, forward, audio, video, player, filled - Bootstrap Icons - BsFastForwardBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFastForwardBtnFill
fast-forward, button, media, control, skip, next, forward, audio, video, outline, player - Bootstrap Icons - BsFastForwardBtn - SVG | WEBP | PNG | JPG - Icon free download
BsFastForwardBtn
fast, forward, fast-forward, circle, media, skip, next, jump, playback, player, control, ui, button, video, audio, music, timeline, speed, motion, quick, shortcut, media-player, round, filled - Bootstrap Icons - BsFastForwardCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFastForwardCircleFill
fast, forward, fast-forward, circle, outline, media, skip, next, jump, player, control, video, audio, music, ui, icon, timeline, motion, speed, quick, media-player - Bootstrap Icons - BsFastForwardCircle - SVG | WEBP | PNG | JPG - Icon free download
BsFastForwardCircle
fast, forward, fast-forward, double-arrow, skip, next, filled, media, player, control, video, audio, music, timeline, jump, motion, quick, ui, button - Bootstrap Icons - BsFastForwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFastForwardFill
fast, forward, fast-forward, skip, next, outline, media, control, player, video, audio, music, timeline, jump, speed, motion, ui - Bootstrap Icons - BsFastForward - SVG | WEBP | PNG | JPG - Icon free download
BsFastForward
file, earmark, font, text, document, typography, writing, editor, layout, style, design, content, formatting, ui - Bootstrap Icons - BsFileEarmarkFontFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkFontFill
file, earmark, image, photo, picture, media, jpeg, png, gallery, asset, upload, download, editor, design, ui - Bootstrap Icons - BsFileEarmarkImageFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkImageFill
file, earmark, image, photo, picture, media, asset, gallery, editor, upload, download, ui - Bootstrap Icons - BsFileEarmarkImage - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkImage
file, earmark, music, audio, sound, mp3, song, playlist, media, track, editor, upload, download, ui - Bootstrap Icons - BsFileEarmarkMusicFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkMusicFill
file, earmark, music, audio, sound, track, song, playlist, media, editor, upload, download, ui - Bootstrap Icons - BsFileEarmarkMusic - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkMusic
file, earmark, play, media, video, movie, clip, playback, player, multimedia, recording, watch, stream, media-file, video-file, play-icon, action, button, ui, media-center - Bootstrap Icons - BsFileEarmarkPlayFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPlayFill
file, earmark, play, video, media, clip, stream, movie, multimedia, playback, player, media-file, video-file, outline-file, button, navigation - Bootstrap Icons - BsFileEarmarkPlay - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPlay
file, earmark, post, message, note, content, blog, article, publish, feed, communication, document, write, form, text-block, announcement - Bootstrap Icons - BsFileEarmarkPostFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPostFill
file, earmark, post, content, article, blog, write, publish, message, announcement, note, outline, editorial, document - Bootstrap Icons - BsFileEarmarkPost - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPost
file, earmark, richtext, rich-text, text, editor, wysiwyg, formatting, document, content, write, notes, paragraph, styled-text - Bootstrap Icons - BsFileEarmarkRichtextFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkRichtextFill
file, earmark, richtext, rich-text, format, editor, wysiwyg, document, content, write, typography, outline, notes - Bootstrap Icons - BsFileEarmarkRichtext - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkRichtext
file, earmark, text, document, note, write, paragraph, content, paper, office, record, report, editor - Bootstrap Icons - BsFileEarmarkTextFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkTextFill
file, earmark, text, document, content, write, paper, note, outline, editor, office, record - Bootstrap Icons - BsFileEarmarkText - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkText
file, earmark, word, doc, docx, ms-word, text, document, editor, write, office, content, report, business-file - Bootstrap Icons - BsFileEarmarkWordFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkWordFill
file, earmark, word, word-file, doc, document, text, ms-word, office, writing, editor, content, page, template, download, upload, open, save, share, toolbar, button, nav, sidebar, ui - Bootstrap Icons - BsFileEarmarkWord - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkWord
file, earmark, document, page, blank-file, template, sheet, content, editor, cms, upload, download, storage, ui, toolbar, menu - Bootstrap Icons - BsFileEarmark - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmark
file, fill, document, page, blank, template, sheet, content, cms, editor, upload, download, storage, ui, placeholder - Bootstrap Icons - BsFileFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileFill
file, image, photo, picture, media, jpg, png, asset, graphic, design, creative, gallery, upload, download, preview - Bootstrap Icons - BsFileImageFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileImageFill
file, image, photo, picture, media, graphic, jpg, png, gallery, asset, upload, download, preview, editor - Bootstrap Icons - BsFileImage - SVG | WEBP | PNG | JPG - Icon free download
BsFileImage
file, music, file-music, audio, song, track, mp3, sound, media, media-file, audio-file, music-note, playlist, library, entertainment, attachment - Bootstrap Icons - BsFileMusicFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileMusicFill
file, music, file-music, audio, track, song, mp3, sound, media, audio-file, music-file, library, playlist, entertainment - Bootstrap Icons - BsFileMusic - SVG | WEBP | PNG | JPG - Icon free download
BsFileMusic
file, play, file-play, video, media, movie, clip, mp4, stream, entertainment, player, media-file, video-file, watch, playback - Bootstrap Icons - BsFilePlayFill - SVG | WEBP | PNG | JPG - Icon free download
BsFilePlayFill
file, play, file-play, video, media, clip, movie, stream, mp4, playback, entertainment, media-file, video-file - Bootstrap Icons - BsFilePlay - SVG | WEBP | PNG | JPG - Icon free download
BsFilePlay
file, post, file-post, message, mail, communication, letter, document, attachment, feed, post-file, announcement, note, office, paper - Bootstrap Icons - BsFilePostFill - SVG | WEBP | PNG | JPG - Icon free download
BsFilePostFill
file, post, file-post, mail, message, communication, document, letter, announcement, note, paper, office, feed - Bootstrap Icons - BsFilePost - SVG | WEBP | PNG | JPG - Icon free download
BsFilePost
file, richtext, file-richtext, text, editor, formatting, document, writing, notes, content, markup, styled-text, article, report, attachment - Bootstrap Icons - BsFileRichtextFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileRichtextFill
file, richtext, file-richtext, text, document, format, writing, notes, editor, styled-text, content, article, report - Bootstrap Icons - BsFileRichtext - SVG | WEBP | PNG | JPG - Icon free download
BsFileRichtext
file, ruled, file-ruled, lined, notes, writing, paper, document, editor, content, school, education, journal, notebook, draft - Bootstrap Icons - BsFileRuledFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileRuledFill
file, text, txt, document, writing, notes, content, filled, draft, editor, report, bootstrap - Bootstrap Icons - BsFileTextFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileTextFill
file, text, txt, document, outline, writing, notes, editor, bootstrap, draft, content - Bootstrap Icons - BsFileText - SVG | WEBP | PNG | JPG - Icon free download
BsFileText
file, word, doc, docx, outline, editor, office-doc, content, bootstrap, document - Bootstrap Icons - BsFileWord - SVG | WEBP | PNG | JPG - Icon free download
BsFileWord
file, doc, document, word, ms-word, text, writing, report, letter, office, editor, template, paper, content, format, word-file, doc-file - Bootstrap Icons - BsFiletypeDoc - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeDoc
file, docx, document, word, ms-word, text, editor, office, writing, report, letter, doc-file, content, upload, template, format, document-file - Bootstrap Icons - BsFiletypeDocx - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeDocx
file, gif, image, animation, loop, media, graphic, web, meme, picture, assets, gallery, upload, preview, image-file - Bootstrap Icons - BsFiletypeGif - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeGif
file, heic, image, high-efficiency, photo, apple, ios, camera, format, picture, compression, media, assets, upload, gallery - Bootstrap Icons - BsFiletypeHeic - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeHeic
file, jpg, jpeg, image, photo, picture, graphic, media, gallery, upload, assets, preview, image-file, photography - Bootstrap Icons - BsFiletypeJpg - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeJpg
file, key, keynote, presentation, slide, apple, mac, deck, talk, ppt, template, design, speaker, office, content, presentation-file - Bootstrap Icons - BsFiletypeKey - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeKey
file, m4p, audio, music, protected, itunes, song, track, media, format, player, sound, library, assets, audio-file - Bootstrap Icons - BsFiletypeM4P - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeM4P
file, md, markdown, readme, docs, text, editor, syntax, developer, note, project, wiki, documentation, content, markup, md-file - Bootstrap Icons - BsFiletypeMd - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeMd
file, mdx, markdown, react, components, docs, documentation, developer, syntax, text, editor, project, content, mdx-file - Bootstrap Icons - BsFiletypeMdx - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeMdx
file, mov, video, quicktime, movie, clip, media, format, editor, timeline, footage, assets, upload, multimedia, playback - Bootstrap Icons - BsFiletypeMov - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeMov
file, mp3, audio, music, song, track, sound, media, playlist, assets, library, player, audio-file, compression - Bootstrap Icons - BsFiletypeMp3 - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeMp3
file, mp4, video, media, movie, clip, player, format, upload, download, gallery, assets, video-file, stream - Bootstrap Icons - BsFiletypeMp4 - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeMp4
file, png, filetype-png, image, raster, graphic, export, asset, photo, screenshot, design, editor, gallery, media, transparent, ui, attachment, download, upload - Bootstrap Icons - BsFiletypePng - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypePng
file, raw, filetype-raw, image, photo, camera, uncompressed, editor, photography, media, asset, design, gallery, import, download, attachment, dslr, workflow - Bootstrap Icons - BsFiletypeRaw - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeRaw
file, tiff, filetype-tiff, image, photo, raster, editor, design, gallery, photography, asset, high-quality, import, download, attachment, media - Bootstrap Icons - BsFiletypeTiff - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeTiff
file, wav, filetype-wav, audio, sound, music, editor, recording, media, sample, track, import, download, attachment, waveform, player, mix, production - Bootstrap Icons - BsFiletypeWav - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeWav
film, movie, video, media, cinema, reel, clip, recording, playback, editor, entertainment, gallery, library, poster, timeline, ui, button, menu - Bootstrap Icons - BsFilm - SVG | WEBP | PNG | JPG - Icon free download
BsFilm
floppy, disk, save, storage, file-save, backup, old-storage, media, document, archive, button, toolbar, ui - Bootstrap Icons - BsFloppy2 - SVG | WEBP | PNG | JPG - Icon free download
BsFloppy2
forward, arrow, next, skip, advance, media, navigation, ui - Bootstrap Icons - BsForward - SVG | WEBP | PNG | JPG - Icon free download
BsForward
fullscreen-exit, exit, fullscreen, shrink, collapse, screen, view, window, ui-control, media, video, player, layout, toolbar, button, interaction - Bootstrap Icons - BsFullscreenExit - SVG | WEBP | PNG | JPG - Icon free download
BsFullscreenExit
fullscreen, expand, open-fullscreen, screen, window, maximize, ui-control, media, player, layout, button, toolbar - Bootstrap Icons - BsFullscreen - SVG | WEBP | PNG | JPG - Icon free download
BsFullscreen
google-play, play-store, android, google, store, app-store, download, install, mobile-app, brand, media, music, movies, apps, triangle-icon - Bootstrap Icons - BsGooglePlay - SVG | WEBP | PNG | JPG - Icon free download
BsGooglePlay
headphones, audio, music, sound, listen, earphones, device, outline, media, entertainment, volume, voice, podcast - Bootstrap Icons - BsHeadphones - SVG | WEBP | PNG | JPG - Icon free download
BsHeadphones
highlighter, marker, pen, edit, write, note, highlight, draw, document, annotation, office-tool, ui-edit - Bootstrap Icons - BsHighlighter - SVG | WEBP | PNG | JPG - Icon free download
BsHighlighter
hr, horizontal-rule, divider, separator, line, break, layout, ui, content, formatting, web-design - Bootstrap Icons - BsHr - SVG | WEBP | PNG | JPG - Icon free download
BsHr
image, photo, image-alt, placeholder, media, picture, gallery, outline, thumbnail, visual, ui - Bootstrap Icons - BsImageAlt - SVG | WEBP | PNG | JPG - Icon free download
BsImageAlt
image, photo, picture, media, filled, gallery, thumbnail, visual, placeholder, ui - Bootstrap Icons - BsImageFill - SVG | WEBP | PNG | JPG - Icon free download
BsImageFill
image, photo, picture, outline, media, thumbnail, visual, gallery, ui, photo-content - Bootstrap Icons - BsImage - SVG | WEBP | PNG | JPG - Icon free download
BsImage
images, photos, multiple-images, gallery, albums, media, outline, visuals, collection, ui - Bootstrap Icons - BsImages - SVG | WEBP | PNG | JPG - Icon free download
BsImages
instagram, brand, logo, social, social-media, camera, stories, photo-sharing, reels, marketing, influencer, profile, app-icon - Bootstrap Icons - BsInstagram - SVG | WEBP | PNG | JPG - Icon free download
BsInstagram
journal, album, book, media, photos, collection, document, notebook, ui, folder, library, archive - Bootstrap Icons - BsJournalAlbum - SVG | WEBP | PNG | JPG - Icon free download
BsJournalAlbum
journal, bookmark, outline, document, saved, notebook, records, tag, highlight, ui - Bootstrap Icons - BsJournalBookmark - SVG | WEBP | PNG | JPG - Icon free download
BsJournalBookmark
layout, sidebar, inset, reverse, layout-sidebar-inset-reverse, two-column, page-template, dashboard, admin, responsive, template, panel, navigation, content, grid - Bootstrap Icons - BsLayoutSidebarInsetReverse - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebarInsetReverse
layout, sidebar, inset, layout-sidebar-inset, two-column, page-template, dashboard, admin, responsive, template, panel, navigation, content, grid - Bootstrap Icons - BsLayoutSidebarInset - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebarInset
layout, sidebar, reverse, layout-sidebar-reverse, left-sidebar, right-sidebar, page-template, dashboard, admin, responsive, navigation, content, panel - Bootstrap Icons - BsLayoutSidebarReverse - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebarReverse
layout, sidebar, layout-sidebar, left-sidebar, right-sidebar, page-template, dashboard, admin, navigation, content, panel, responsive, template - Bootstrap Icons - BsLayoutSidebar - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebar
layout, split, layout-split, two-column, split-view, divider, panel, dashboard, admin, responsive, content, template, grid - Bootstrap Icons - BsLayoutSplit - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSplit
layout, three-columns, 3-column, grid, layout-three-columns, multi-column, panel, dashboard, admin, responsive, template, content - Bootstrap Icons - BsLayoutThreeColumns - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutThreeColumns
list, columns, reverse, layout, grid, table, arrangement, structure, organize, outline, ui, content - Bootstrap Icons - BsListColumnsReverse - SVG | WEBP | PNG | JPG - Icon free download
BsListColumnsReverse
list, columns, layout, table, grid, structure, content, organize, outline, ui - Bootstrap Icons - BsListColumns - SVG | WEBP | PNG | JPG - Icon free download
BsListColumns
list, ol, ordered, numbers, steps, sequence, outline, ui, tasks, instructions, content - Bootstrap Icons - BsListOl - SVG | WEBP | PNG | JPG - Icon free download
BsListOl
list, stars, favorite-list, rating-list, highlight, featured, outline, ui, special, content - Bootstrap Icons - BsListStars - SVG | WEBP | PNG | JPG - Icon free download
BsListStars
list, ul, unordered-list, bullet-list, text, content, items, menu, navigation, structure, layout, document, notes, tasks, todo, outline, web, app, ui, sidebar, panel, markdown, rich-text - Bootstrap Icons - BsListUl - SVG | WEBP | PNG | JPG - Icon free download
BsListUl
list, menu, items, nav, navigation, text, content, outline, tasks, todo, notes, structure, layout, sidebar, ui, web, app, panel, table-of-contents - Bootstrap Icons - BsList - SVG | WEBP | PNG | JPG - Icon free download
BsList
markdown, md, text, format, developer, writer, editor, docs, syntax, filled, markup, content, readme, documentation, coding - Bootstrap Icons - BsMarkdownFill - SVG | WEBP | PNG | JPG - Icon free download
BsMarkdownFill
markdown, md, markup, syntax, text, editor, docs, developer, readme, content, outline, programming, file-format - Bootstrap Icons - BsMarkdown - SVG | WEBP | PNG | JPG - Icon free download
BsMarkdown
marker, tip, pen, highlight, writing, drawing, edit, tool, office, design, sketch, note, annotate, pointer - Bootstrap Icons - BsMarkerTip - SVG | WEBP | PNG | JPG - Icon free download
BsMarkerTip
medium, brand, logo, writing, blog, article, publisher, content, read, share, platform, social, publication, editorial, story, post, brand-icon - Bootstrap Icons - BsMedium - SVG | WEBP | PNG | JPG - Icon free download
BsMedium
music, note, music-note, beamed-note, audio, sound, song, track, tune, melody, playlist, music-player, media, entertainment, dj, composer, soundtrack - Bootstrap Icons - BsMusicNoteBeamed - SVG | WEBP | PNG | JPG - Icon free download
BsMusicNoteBeamed
music, note, music-list, playlist, audio, queue, track-list, song-list, media, entertainment, sound, tune, melody, library, music-library - Bootstrap Icons - BsMusicNoteList - SVG | WEBP | PNG | JPG - Icon free download
BsMusicNoteList
music, note, audio, sound, melody, tune, track, song, music-icon, entertainment, media, soundtrack - Bootstrap Icons - BsMusicNote - SVG | WEBP | PNG | JPG - Icon free download
BsMusicNote
music-player, audio-player, media-player, playback, control, sound, song, track, media, entertainment, interface - Bootstrap Icons - BsMusicPlayer - SVG | WEBP | PNG | JPG - Icon free download
BsMusicPlayer
newspaper, news, article, journal, press, newsletter, headline, report, media, information, update, feed, publication - Bootstrap Icons - BsNewspaper - SVG | WEBP | PNG | JPG - Icon free download
BsNewspaper
noise, reduction, audio-filter, sound-clean, noise-cancel, audio-edit, media, sound, waveform, audio-processing, filter - Bootstrap Icons - BsNoiseReduction - SVG | WEBP | PNG | JPG - Icon free download
BsNoiseReduction
octagon, shape, eight-sided, polygon, geometry, frame, border, container, stop-shape, warning, highlight, ui-shape, outline, badge, symbol - Bootstrap Icons - BsOctagon - SVG | WEBP | PNG | JPG - Icon free download
BsOctagon
optical, audio, optical-audio, digital-audio, toslink, sound, speaker, media, music, cinema, home-theater, port, connection, filled, signal - Bootstrap Icons - BsOpticalAudioFill - SVG | WEBP | PNG | JPG - Icon free download
BsOpticalAudioFill
optical, audio, optical-audio, digital-audio, toslink, sound, speaker, media, music, connection, port, signal, outline, device-settings - Bootstrap Icons - BsOpticalAudio - SVG | WEBP | PNG | JPG - Icon free download
BsOpticalAudio
pause, button, media, control, playback, stop, filled, ui, player, audio, video, symbol - Bootstrap Icons - BsPauseBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsPauseBtnFill
pause, button, media, control, playback, stop, outline, ui, audio, video, player - Bootstrap Icons - BsPauseBtn - SVG | WEBP | PNG | JPG - Icon free download
BsPauseBtn
pause, circle, media, control, playback, filled, player, audio, video, symbol, ui - Bootstrap Icons - BsPauseCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsPauseCircleFill
pause, circle, media, control, playback, outline, audio, video, symbol, ui - Bootstrap Icons - BsPauseCircle - SVG | WEBP | PNG | JPG - Icon free download
BsPauseCircle
pause, media, control, playback, stop, filled, audio, video, ui, symbol - Bootstrap Icons - BsPauseFill - SVG | WEBP | PNG | JPG - Icon free download
BsPauseFill
pause, media, control, playback, stop, outline, audio, video, ui, symbol - Bootstrap Icons - BsPause - SVG | WEBP | PNG | JPG - Icon free download
BsPause
pci, card, sound, audio-card, sound-card, hardware, audio, speaker, multimedia, chip, module, device, system, music, media, tech, pc - Bootstrap Icons - BsPciCardSound - SVG | WEBP | PNG | JPG - Icon free download
BsPciCardSound
person, bounding-box, crop, frame, user, avatar, profile, focus, selection, highlight, ui, container - Bootstrap Icons - BsPersonBoundingBox - SVG | WEBP | PNG | JPG - Icon free download
BsPersonBoundingBox
pinterest, brand, logo, social, social-media, share, pin, board, content, images, inspiration, marketing, platform, pinterest-brand, social-share - Bootstrap Icons - BsPinterest - SVG | WEBP | PNG | JPG - Icon free download
BsPinterest
pip, picture-in-picture, mini-player, video, window, overlay, media, popout, playback, streaming, tv, multimedia, ui, button, player - Bootstrap Icons - BsPipFill - SVG | WEBP | PNG | JPG - Icon free download
BsPipFill
pip, picture-in-picture, mini-player, video, player, overlay, popout, streaming, tv, media, ui, control, toolbar - Bootstrap Icons - BsPip - SVG | WEBP | PNG | JPG - Icon free download
BsPip
play, button, play-btn, media, start, video, audio, music, stream, multimedia, ui, control, player, click, action, toolbar - Bootstrap Icons - BsPlayBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsPlayBtnFill
play, button, play-btn, media, start, video, audio, music, stream, control, ui, player, toolbar, click - Bootstrap Icons - BsPlayBtn - SVG | WEBP | PNG | JPG - Icon free download
BsPlayBtn
play, circle, play-circle, media, start, video, audio, music, stream, player, ui, icon, toolbar, round - Bootstrap Icons - BsPlayCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsPlayCircleFill
play, circle, play-circle, media, start, video, audio, music, stream, control, ui, player, thin - Bootstrap Icons - BsPlayCircle - SVG | WEBP | PNG | JPG - Icon free download
BsPlayCircle
play, triangle, media, start, video, audio, music, stream, player, control, multimedia, ui - Bootstrap Icons - BsPlayFill - SVG | WEBP | PNG | JPG - Icon free download
BsPlayFill
play, triangle, media, start, video, audio, music, stream, control, player, ui, thin, icon - Bootstrap Icons - BsPlay - SVG | WEBP | PNG | JPG - Icon free download
BsPlay
projector, presentation, display, filled, media, screen, office - Bootstrap Icons - BsProjectorFill - SVG | WEBP | PNG | JPG - Icon free download
BsProjectorFill
projector, presentation, display, outline, meeting, screen, media - Bootstrap Icons - BsProjector - SVG | WEBP | PNG | JPG - Icon free download
BsProjector
record, record-btn, filled, media, audio, video, mic, start-recording, capture, button, ui-control, circle, red-dot, rec, multimedia - Bootstrap Icons - BsRecordBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsRecordBtnFill
record, record-btn, media, audio, video, capture, mic, recording, ui-control, circle, rec, outline - Bootstrap Icons - BsRecordBtn - SVG | WEBP | PNG | JPG - Icon free download
BsRecordBtn
record, circle, outline, record-circle, audio, video, capture, mic, rec, button, media, ui-control - Bootstrap Icons - BsRecordCircle - SVG | WEBP | PNG | JPG - Icon free download
BsRecordCircle
record, filled, dot, circle, rec, button, capture, audio, video, media, recording, ui-control - Bootstrap Icons - BsRecordFill - SVG | WEBP | PNG | JPG - Icon free download
BsRecordFill
record, outline, dot, circle, rec, media, audio, video, capture, recording, ui-control - Bootstrap Icons - BsRecord - SVG | WEBP | PNG | JPG - Icon free download
BsRecord
record2, filled, double-circle, media, audio, video, capture, recording, rec, button, control - Bootstrap Icons - BsRecord2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsRecord2Fill
record2, outline, double-circle, media, audio, video, capture, recording, rec, button, control - Bootstrap Icons - BsRecord2 - SVG | WEBP | PNG | JPG - Icon free download
BsRecord2
repeat, repeat-1, one, loop, single-loop, media, audio, video, track, song, music, playback, rewind, forward, player, controls, button, ui, ux, toolbar, sidebar, navigation, ios, android, web, component, icon - Bootstrap Icons - BsRepeat1 - SVG | WEBP | PNG | JPG - Icon free download
BsRepeat1
repeat, loop, cycle, replay, redo, media, audio, video, playback, controls, ui, ux, button, toolbar, navigation, refresh, sync, cycle-action, rotate, player, track, music - Bootstrap Icons - BsRepeat - SVG | WEBP | PNG | JPG - Icon free download
BsRepeat
rewind, rewind-btn, backward, media, audio, video, song, track, player, controls, button, filled, ui, ux, toolbar, skip-back, fast-backward - Bootstrap Icons - BsRewindBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsRewindBtnFill
rewind, rewind-btn, backward, skip-back, media, audio, video, track, player, controls, button, outline, ui, ux, toolbar, navigation - Bootstrap Icons - BsRewindBtn - SVG | WEBP | PNG | JPG - Icon free download
BsRewindBtn
rewind, rewind-circle, circle, backward, media, audio, video, player, controls, icon, button, ui, ux, skip-back, navigation - Bootstrap Icons - BsRewindCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsRewindCircleFill
rewind, rewind-circle, circle, backward, media, audio, video, track, controls, outline, ui, ux, player, navigation - Bootstrap Icons - BsRewindCircle - SVG | WEBP | PNG | JPG - Icon free download
BsRewindCircle
rewind, backward, media, audio, video, track, filled, player, controls, skip-back, button, ui, ux, navigation - Bootstrap Icons - BsRewindFill - SVG | WEBP | PNG | JPG - Icon free download
BsRewindFill
rewind, backward, media, audio, video, track, outline, controls, player, skip-back, navigation, ui, ux - Bootstrap Icons - BsRewind - SVG | WEBP | PNG | JPG - Icon free download
BsRewind
rss, feed, subscribe, subscription, broadcast, news, updates, blog, content, signal, radio, filled, icon, web, reader, posts, alerts, notifications - Bootstrap Icons - BsRssFill - SVG | WEBP | PNG | JPG - Icon free download
BsRssFill
rss, feed, subscription, broadcast, news, updates, syndication, web-feed, notify, blog, content, signal, radio, icon, header, footer, sidebar, button, widget, aggregator - Bootstrap Icons - BsRss - SVG | WEBP | PNG | JPG - Icon free download
BsRss
sd, sd-card, memory, flash, storage, filled, device, media, camera, recording, backup - Bootstrap Icons - BsSdCardFill - SVG | WEBP | PNG | JPG - Icon free download
BsSdCardFill
sd, sd-card, memory, outline, storage, flash, device, camera, media, removable - Bootstrap Icons - BsSdCard - SVG | WEBP | PNG | JPG - Icon free download
BsSdCard
sina, weibo, sina-weibo, china, microblogging, social, platform, brand, logo, network, sharing, community, post, feed - Bootstrap Icons - BsSinaWeibo - SVG | WEBP | PNG | JPG - Icon free download
BsSinaWeibo
skip, backward, button, media, control, rewind, audio, video, player, previous, track, filled, ui, playback - Bootstrap Icons - BsSkipBackwardBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackwardBtnFill
skip, backward, button, media, control, rewind, audio, video, player, previous, track, line, playback - Bootstrap Icons - BsSkipBackwardBtn - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackwardBtn
skip, backward, circle, media, control, rewind, previous, track, audio, video, player, filled, round - Bootstrap Icons - BsSkipBackwardCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackwardCircleFill
skip, backward, circle, media, control, rewind, audio, video, player, previous, track, line, round - Bootstrap Icons - BsSkipBackwardCircle - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackwardCircle
skip, backward, rewind, media, control, audio, video, player, previous, track, filled, playback - Bootstrap Icons - BsSkipBackwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackwardFill
skip, backward, rewind, media, control, audio, video, previous, track, player, line, playback - Bootstrap Icons - BsSkipBackward - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackward
skip, end, button, media, control, fast-forward, next, track, audio, video, player, filled, playback - Bootstrap Icons - BsSkipEndBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipEndBtnFill
skip, end, skip-end, button, media, control, next, forward, end-track, move-end, player, audio, video, playlist, toolbar, ui, navigation, icon-button, track-end, song-end, episode-end, skip-button, media-skip, media-next, compact-control, ios, android, web - Bootstrap Icons - BsSkipEndBtn - SVG | WEBP | PNG | JPG - Icon free download
BsSkipEndBtn
skip, end, circle, filled, skip-end, media, control, circle-button, round-icon, playlist, forward, next, track-end, ui, player, audio-control, video-control, skip-circle, navigation, media-next, media-skip, round-control, hover-control - Bootstrap Icons - BsSkipEndCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipEndCircleFill
skip, end, circle, outline, skip-end, media, control, next, forward, track-end, round, ui, thin-line, video, audio, playlist, media-navigation, round-outline, circle-outline, media-skip, media-next, lightweight-icon - Bootstrap Icons - BsSkipEndCircle - SVG | WEBP | PNG | JPG - Icon free download
BsSkipEndCircle
skip, end, filled, skip-end, media, control, next, forward, track-end, audio, video, playlist, player, media-button, media-skip, media-next, ui, bold-icon, compact-control, skip-action, navigation-control - Bootstrap Icons - BsSkipEndFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipEndFill
skip, end, skip-end, line, media, control, next, forward, track-end, playlist, audio, video, media-skip, media-next, navigation, thin-icon, player-control, ui, media-navigation, simple-control - Bootstrap Icons - BsSkipEnd - SVG | WEBP | PNG | JPG - Icon free download
BsSkipEnd
skip, forward, filled, button, skip-forward, media, control, next, advance, track-forward, audio, video, playlist, player, fast-forward, media-next, media-skip, ui-control, toolbar, button-icon, compact-media-control - Bootstrap Icons - BsSkipForwardBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipForwardBtnFill
skip, forward, button, skip-forward, media, control, next, advance, track-forward, audio, video, playlist, player, media-skip, media-next, toolbar, ui-control, icon-button, simple-control - Bootstrap Icons - BsSkipForwardBtn - SVG | WEBP | PNG | JPG - Icon free download
BsSkipForwardBtn
skip, forward, circle, filled, skip-forward, media, control, next, advance, round, track-forward, audio, video, playlist, player, media-next, media-skip, circular-button, ui-control, navigation, media-icon, round-filled - Bootstrap Icons - BsSkipForwardCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipForwardCircleFill
skip, forward, circle, outline, skip-forward, media, control, next, advance, round, track-forward, audio, video, playlist, ui, player, media-navigation, media-skip, minimal-circle, thin-outline, rounded-control - Bootstrap Icons - BsSkipForwardCircle - SVG | WEBP | PNG | JPG - Icon free download
BsSkipForwardCircle
skip, forward, filled, skip-forward, media, control, next, track-forward, advance, audio, video, playlist, player, media-skip, media-next, bold-control, compact-control, ui, navigation - Bootstrap Icons - BsSkipForwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipForwardFill
skip, forward, line, skip-forward, media, control, next, advance, track-forward, playlist, audio, video, ui, media-next, media-skip, navigation, minimal-control - Bootstrap Icons - BsSkipForward - SVG | WEBP | PNG | JPG - Icon free download
BsSkipForward
skip, start, filled, button, skip-start, media, control, previous, back, track-start, audio, video, playlist, player, media-prev, media-back, toolbar, navigation-control, ui, media-button - Bootstrap Icons - BsSkipStartBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipStartBtnFill
skip, start, button, skip-start, media, control, previous, back, track-start, audio, video, playlist, player, ui-control, toolbar, media-prev, media-back, icon-button - Bootstrap Icons - BsSkipStartBtn - SVG | WEBP | PNG | JPG - Icon free download
BsSkipStartBtn
skip, start, circle, filled, skip-start, media, control, previous, back, track-start, round, audio, video, playlist, player, media-prev, media-back, round-button, circle-icon, ui, media-skip, media-navigation - Bootstrap Icons - BsSkipStartCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipStartCircleFill
skip, start, circle, outline, skip-start, media, control, previous, back, track-start, audio, video, playlist, player, media-prev, media-back, round, thin-outline, ui, circular-control - Bootstrap Icons - BsSkipStartCircle - SVG | WEBP | PNG | JPG - Icon free download
BsSkipStartCircle
skip, start, filled, skip-start, media, control, previous, back, track-start, audio, video, playlist, player, media-prev, media-back, bold-icon, compact-control, navigation-control - Bootstrap Icons - BsSkipStartFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipStartFill
skip, start, line, skip-start, media, control, previous, back, track-start, audio, video, playlist, player, ui, minimal-icon, media-prev, media-back, navigation - Bootstrap Icons - BsSkipStart - SVG | WEBP | PNG | JPG - Icon free download
BsSkipStart
snapchat, snap, snapchat-logo, brand, social, social-network, messaging, stories, camera, share, profile, auth, oauth, social-icon, bootstrap, icon - Bootstrap Icons - BsSnapchat - SVG | WEBP | PNG | JPG - Icon free download
BsSnapchat
sound, wave, audio, signal, waveform, music, record, mic, voice, frequency, vibration, ui, equalizer, sound-level, audio-visual, media - Bootstrap Icons - BsSoundwave - SVG | WEBP | PNG | JPG - Icon free download
BsSoundwave
speaker, sound, audio, volume, loud, device, speaker-filled, music, media, playlist, ui, button, toggle, sound-on, output - Bootstrap Icons - BsSpeakerFill - SVG | WEBP | PNG | JPG - Icon free download
BsSpeakerFill
speaker, sound, audio, volume, device, music, media, sound-icon, ui, mute-toggle, output, playlist - Bootstrap Icons - BsSpeaker - SVG | WEBP | PNG | JPG - Icon free download
BsSpeaker
spellcheck, check, text, typo, edit, correct, grammar, proofread, writing, ui, document, content, editor, validation - Bootstrap Icons - BsSpellcheck - SVG | WEBP | PNG | JPG - Icon free download
BsSpellcheck
spotify, brand, logo, music, streaming, playlist, audio, app, entertainment, media, sound - Bootstrap Icons - BsSpotify - SVG | WEBP | PNG | JPG - Icon free download
BsSpotify
star, filled, favorite, rate, rating, bookmark, highlight, mark, ui, feedback, score, favourite, icon - Bootstrap Icons - BsStarFill - SVG | WEBP | PNG | JPG - Icon free download
BsStarFill
star, half, rating, partial, score, favorite, favourite, ui, review, feedback, highlight - Bootstrap Icons - BsStarHalf - SVG | WEBP | PNG | JPG - Icon free download
BsStarHalf
star, outline, rating, favorite, favourite, review, score, feedback, bookmark, ui, highlight - Bootstrap Icons - BsStar - SVG | WEBP | PNG | JPG - Icon free download
BsStar
stars, rating, favorites, favorite, rate, score, review, highlight, bookmark, mark, ui, badge, icon, star-group, cluster, rating-stars, feedback-stars, header, footer, sidebar, android, ios, material, fluent - Bootstrap Icons - BsStars - SVG | WEBP | PNG | JPG - Icon free download
BsStars
stop, button, stop-button, media, control, filled, player, pause, halt, recording-stop, audio, video, ui, toolbar, media-player - Bootstrap Icons - BsStopBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsStopBtnFill
stop, button, stop-button, media, player, outline, control, halt, pause, audio, video, recording-stop, ui, toolbar - Bootstrap Icons - BsStopBtn - SVG | WEBP | PNG | JPG - Icon free download
BsStopBtn
stop, circle, stop-circle, filled, media, player, control, halt, audio, video, record, recording-stop, ui, round-button, toolbar - Bootstrap Icons - BsStopCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsStopCircleFill
stop, circle, stop-circle, outline, media, control, halt, audio, video, recording, ui, toolbar, player - Bootstrap Icons - BsStopCircle - SVG | WEBP | PNG | JPG - Icon free download
BsStopCircle
stop, filled, stop-icon, halt, pause, media, video, audio, recording-stop, square-stop, ui, toolbar, button - Bootstrap Icons - BsStopFill - SVG | WEBP | PNG | JPG - Icon free download
BsStopFill
stop, outline, halt, pause, media, audio, video, recording-stop, ui, square-stop, toolbar, player - Bootstrap Icons - BsStop - SVG | WEBP | PNG | JPG - Icon free download
BsStop
substack, brand, blog, newsletter, writer, publication, content, media, post, article, platform, logo, brand-logo, email-newsletter, creator - Bootstrap Icons - BsSubstack - SVG | WEBP | PNG | JPG - Icon free download
BsSubstack
text, indent, indent-right, format, align, paragraph, spacing, editor, rich-text, document, layout, ui, toolbar, button, writing, content, toggle, navigation, sidebar, shift, move, arrow, ios, android, web - Bootstrap Icons - BsTextIndentRight - SVG | WEBP | PNG | JPG - Icon free download
BsTextIndentRight
text, left, text-left, align-left, alignment, paragraph, editor, format, writing, document, ui, toolbar, content, layout, button, typography, ios, android, web - Bootstrap Icons - BsTextLeft - SVG | WEBP | PNG | JPG - Icon free download
BsTextLeft
text, paragraph, format, writing, editor, rich-text, content, document, ui, toolbar, typography, block, layout, section, ios, android, web - Bootstrap Icons - BsTextParagraph - SVG | WEBP | PNG | JPG - Icon free download
BsTextParagraph
text, right, text-right, align-right, alignment, format, editor, document, writing, typography, ui, layout, toolbar, button, content, ios, android, web - Bootstrap Icons - BsTextRight - SVG | WEBP | PNG | JPG - Icon free download
BsTextRight
text, wrap, text-wrap, line-wrap, wrapping, format, paragraph, editor, typography, document, content, layout, ui, button, toggle, ios, android, web - Bootstrap Icons - BsTextWrap - SVG | WEBP | PNG | JPG - Icon free download
BsTextWrap
textarea, t, text, input, field, form, typing, editor, ui, layout, content, writing, box, ios, android, web - Bootstrap Icons - BsTextareaT - SVG | WEBP | PNG | JPG - Icon free download
BsTextareaT
textarea, input, text-field, form, typing, editor, content, write, ui, box, layout, ios, android, web - Bootstrap Icons - BsTextarea - SVG | WEBP | PNG | JPG - Icon free download
BsTextarea
threads, threads-fill, meta, instagram-threads, brand, social, network, platform, logo, chat, feed, community, conversation, profile, social-media, ios, android, web - Bootstrap Icons - BsThreadsFill - SVG | WEBP | PNG | JPG - Icon free download
BsThreadsFill
threads, meta, instagram-threads, brand, platform, social, communication, chat, feed, logo, social-media, community, conversation, profile, ios, android - Bootstrap Icons - BsThreads - SVG | WEBP | PNG | JPG - Icon free download
BsThreads
tiktok, brand, logo, social, social-media, video, short-video, creator, influencer, entertainment, music, app, platform, share, media, marketing - Bootstrap Icons - BsTiktok - SVG | WEBP | PNG | JPG - Icon free download
BsTiktok
tv, television, screen, display, monitor, media, video, movie, streaming, entertainment, device, electronics, filled, dashboard-widget - Bootstrap Icons - BsTvFill - SVG | WEBP | PNG | JPG - Icon free download
BsTvFill
tv, television, screen, display, monitor, media, video, movie, streaming, entertainment, device, electronics, outline - Bootstrap Icons - BsTv - SVG | WEBP | PNG | JPG - Icon free download
BsTv
twitch, brand, logo, streaming, live-stream, gaming, esports, social, media, video, content-creator, platform - Bootstrap Icons - BsTwitch - SVG | WEBP | PNG | JPG - Icon free download
BsTwitch
twitter, x, twitter-x, brand, logo, social, media, microblog, tweet, post, share, platform - Bootstrap Icons - BsTwitterX - SVG | WEBP | PNG | JPG - Icon free download
BsTwitterX
twitter, bird, tweet, brand, logo, social, media, microblog, post, share, community - Bootstrap Icons - BsTwitter - SVG | WEBP | PNG | JPG - Icon free download
BsTwitter
unindent, text, editor, layout, format, paragraph, alignment, outdent, indentation, toolbar, document, writer, content - Bootstrap Icons - BsUnindent - SVG | WEBP | PNG | JPG - Icon free download
BsUnindent
view, list, view-list, items, rows, menu, layout, navigation, organize, display, ui, sidebar, toolbar, outline, table, content - Bootstrap Icons - BsViewList - SVG | WEBP | PNG | JPG - Icon free download
BsViewList
view, stacked, view-stacked, layers, cards, tiles, layout, ui, stack, column, organize, content, outline, navigation, dashboard - Bootstrap Icons - BsViewStacked - SVG | WEBP | PNG | JPG - Icon free download
BsViewStacked
vignette, photo-effect, darken-edges, filter, edit, image, photography, visual, effect, media, outline, lens, shadow, editing - Bootstrap Icons - BsVignette - SVG | WEBP | PNG | JPG - Icon free download
BsVignette
vimeo, brand, logo, video, hosting, streaming, media, social, platform, content, creator, share, publish, brand-icon, video-platform - Bootstrap Icons - BsVimeo - SVG | WEBP | PNG | JPG - Icon free download
BsVimeo
vinyl, record, disc, music, audio, retro, analog, sound, playlist, album, turntable, filled, media, entertainment, track - Bootstrap Icons - BsVinylFill - SVG | WEBP | PNG | JPG - Icon free download
BsVinylFill
vinyl, record, disc, music, audio, retro, sound, analog, album, turntable, outline, media, track, playlist - Bootstrap Icons - BsVinyl - SVG | WEBP | PNG | JPG - Icon free download
BsVinyl
wikipedia, wiki, brand, encyclopedia, knowledge, content, reference, education, learning, articles, information - Bootstrap Icons - BsWikipedia - SVG | WEBP | PNG | JPG - Icon free download
BsWikipedia
wordpress, wp, cms, blog, brand, website, publishing, platform, content, editor - Bootstrap Icons - BsWordpress - SVG | WEBP | PNG | JPG - Icon free download
BsWordpress
youtube, brand, video, media, play, content, channel, streaming, social, creator - Bootstrap Icons - BsYoutube - SVG | WEBP | PNG | JPG - Icon free download
BsYoutube
album, photo-album, music-album, collection, media, folder, gallery, playlist, cover, media-library, archive, multimedia - css.gg Icons - CgAlbum - SVG | WEBP | PNG | JPG - Icon free download
CgAlbum
asterisk, star, required, mandatory, special-char, symbol, note, footnote, form, highlight, attention - css.gg Icons - CgAsterisk - SVG | WEBP | PNG | JPG - Icon free download
CgAsterisk
browse, explore, navigation, search, discover, directory, file-browse, content, view, ui-action, internet, website - css.gg Icons - CgBrowse - SVG | WEBP | PNG | JPG - Icon free download
CgBrowse
calendar, today, current-day, highlight, date, event, daily, schedule, planner, tasks, navigation - css.gg Icons - CgCalendarToday - SVG | WEBP | PNG | JPG - Icon free download
CgCalendarToday
camera, photo, photography, capture, image, media, shoot, record, lens, multimedia, gallery, content, snapshot - css.gg Icons - CgCamera - SVG | WEBP | PNG | JPG - Icon free download
CgCamera
captions, subtitles, text, cc, closed-caption, video, media, accessibility, audio, translation, transcript - css.gg Icons - CgCaptions - SVG | WEBP | PNG | JPG - Icon free download
CgCaptions
carousel, slider, gallery, slideshow, media-slider, ui-component, navigation, rotate, scroll, banner, image-rotation - css.gg Icons - CgCarousel - SVG | WEBP | PNG | JPG - Icon free download
CgCarousel
cast, stream, chromecast, airplay, screen-share, mirror, broadcast, wifi, wireless, device, media, tv - css.gg Icons - CgCast - SVG | WEBP | PNG | JPG - Icon free download
CgCast
chevron, double, right, regular, chevron-double-right, arrow, arrow-right, next, navigate, forward, scroll, ui, button, carousel, tabs, sidebar, minimal, flat, line - css.gg Icons - CgChevronDoubleRightR - SVG | WEBP | PNG | JPG - Icon free download
CgChevronDoubleRightR
chevron, double, right, solid, chevron-double-right, arrow, arrow-right, forward, next, navigate, jump, skip, carousel, scroll, menu, tabs, button, bold - css.gg Icons - CgChevronDoubleRight - SVG | WEBP | PNG | JPG - Icon free download
CgChevronDoubleRight
chevron, left, chevron-left, outline, arrow-left, navigate, back, previous, scroll, carousel, ui, minimal, thin, button, sidebar - css.gg Icons - CgChevronLeftO - SVG | WEBP | PNG | JPG - Icon free download
CgChevronLeftO
cg, chevron, left, chevron-left, left-chevron, left-arrow, back, previous, pagination, carousel, slider, nav, sidebar, header, button, icon-button, arrow, ui-control, click, tap, regular - css.gg Icons - CgChevronLeftR - SVG | WEBP | PNG | JPG - Icon free download
CgChevronLeftR
cg, chevron, left, chevron-left, left-chevron, left-arrow, back, previous, pagination, carousel, slider, nav, sidebar, header, button, icon-button, arrow, line, thin, ui-control - css.gg Icons - CgChevronLeft - SVG | WEBP | PNG | JPG - Icon free download
CgChevronLeft
cg, chevron, right, chevron-right, right-chevron, right-arrow, next, forward, pagination, carousel, slider, nav, button, icon-button, outline, arrow, navigation-control, hover, active - css.gg Icons - CgChevronRightO - SVG | WEBP | PNG | JPG - Icon free download
CgChevronRightO
cg, chevron, right, chevron-right, right-chevron, right-arrow, next, forward, pagination, carousel, slider, nav, sidebar, header, button, icon-button, arrow, regular, ui-control - css.gg Icons - CgChevronRightR - SVG | WEBP | PNG | JPG - Icon free download
CgChevronRightR
cg, chevron, right, chevron-right, right-chevron, right-arrow, next, forward, pagination, carousel, slider, nav, sidebar, header, button, icon-button, arrow, line, thin - css.gg Icons - CgChevronRight - SVG | WEBP | PNG | JPG - Icon free download
CgChevronRight
cg, clapperboard, clapper, movie, film, video, media, production, shoot, scene, cinema, editor, playback, project, media-control, line, icon-button, toolbar, badge - css.gg Icons - CgClapperBoard - SVG | WEBP | PNG | JPG - Icon free download
CgClapperBoard
comedy, central, comedy-central, brand, logo, tv, media, entertainment, channel, network, brand-icon, show, humor, funny - css.gg Icons - CgComedyCentral - SVG | WEBP | PNG | JPG - Icon free download
CgComedyCentral
copy, duplicate, clone, clipboard, files, document, copy-file, editor, ui-action, duplicate-item, save-copy, content, copy-paste, utility - css.gg Icons - CgCopy - SVG | WEBP | PNG | JPG - Icon free download
CgCopy
crowdfire, brand, logo, social, media, marketing, automation, content, scheduler, app, platform, influencer, engagement, promotion, branding, social-media - css.gg Icons - CgCrowdfire - SVG | WEBP | PNG | JPG - Icon free download
CgCrowdfire
designmodo, brand, logo, design, ui, ux, framework, builder, website, platform, marketing, branding, content, tool, web - css.gg Icons - CgDesignmodo - SVG | WEBP | PNG | JPG - Icon free download
CgDesignmodo
disc, cd, dvd, media, music, album, track, audio, playlist, storage, record, optical disc, collection, file icon, library, sound, player, ui button, toolbox, asset - css.gg Icons - CgDisc - SVG | WEBP | PNG | JPG - Icon free download
CgDisc
exposure, edit exposure, photo exposure, image edit, lighting, brightness, highlight, shadow, camera, dslr, image control, editor, filter, tone curve, ui, toolbar, panel, lens, iso, web app, mobile app - css.gg Icons - CgEditExposure - SVG | WEBP | PNG | JPG - Icon free download
CgEditExposure
highlight, edit highlight, lighten, exposure, brightness, photo edit, image highlight, editor, filter, tone, contrast, ui tool, design tool, masking, lighting, panel, toolbar, adjust - css.gg Icons - CgEditHighlight - SVG | WEBP | PNG | JPG - Icon free download
CgEditHighlight
markup, edit markup, annotation, draw, sketch, highlight, note, pointer, pen tool, editor, documentation, ui tool, overlay, comment, shape tool, mark, review, revision, markup mode, design workflow - css.gg Icons - CgEditMarkup - SVG | WEBP | PNG | JPG - Icon free download
CgEditMarkup
mask, edit mask, layer mask, selection, cutout, image mask, photo edit, editor, design tool, masking, overlay, alpha mask, vector mask, ui tool, panel, workflow, effects, highlight, adjustment mask - css.gg Icons - CgEditMask - SVG | WEBP | PNG | JPG - Icon free download
CgEditMask
ereader, ebook, reader, digital book, tablet, kindle, reading, study, learning, content, article, news, document, device, mobile, screen, text, library, education, publication - css.gg Icons - CgEreader - SVG | WEBP | PNG | JPG - Icon free download
CgEreader
facebook, fb, social media, brand, logo, network, community, share, post, platform, messaging, profile, timeline, social network, meta, promotion, marketing, follow - css.gg Icons - CgFacebook - SVG | WEBP | PNG | JPG - Icon free download
CgFacebook
feed, news, timeline, activity, updates, stream, content, post list, scroll, dashboard, social, ui, menu, sidebar, navigation, widget, ios, android, material - css.gg Icons - CgFeed - SVG | WEBP | PNG | JPG - Icon free download
CgFeed
film, movie, video, cinema, reel, footage, clip, media, recording, entertainment, playback, editor, timeline, camera, multimedia, ios, android - css.gg Icons - CgFilm - SVG | WEBP | PNG | JPG - Icon free download
CgFilm
font height, text height, line height, typography, font size, text spacing, editor, formatting, ui, toolbar, design, content, document, adjust, spacing, layout, web design, css, writing, editing, ios, android, web app - css.gg Icons - CgFontHeight - SVG | WEBP | PNG | JPG - Icon free download
CgFontHeight
font spacing, letter spacing, kerning, typography, text spacing, editor, format, adjust, design, layout, ui, toolbar, document, content, writing, css, text editor, ios, android, web app - css.gg Icons - CgFontSpacing - SVG | WEBP | PNG | JPG - Icon free download
CgFontSpacing
bold, format bold, text bold, typography, font weight, strong, editor, formatting, ui, toolbar, button, document, content, writing, highlight, emphasis, css, web design, ios, android, web app - css.gg Icons - CgFormatBold - SVG | WEBP | PNG | JPG - Icon free download
CgFormatBold
center, format center, text center, align center, alignment, typography, editor, layout, formatting, ui, toolbar, document, content, writing, css, web design, ios, android, web app - css.gg Icons - CgFormatCenter - SVG | WEBP | PNG | JPG - Icon free download
CgFormatCenter
format color, text color, color picker, font color, palette, styling, design, editor, formatting, ui, toolbar, paint, highlight, document, content, css, web design, ios, android, web app, color tool - css.gg Icons - CgFormatColor - SVG | WEBP | PNG | JPG - Icon free download
CgFormatColor
heading, format heading, h1, h2, title text, typography, editor, document, section title, layout, formatting, ui, toolbar, content, writing, css, web design, ios, android, web app - css.gg Icons - CgFormatHeading - SVG | WEBP | PNG | JPG - Icon free download
CgFormatHeading
indent decrease, outdent, format indent decrease, reduce indent, text indent, typography, editor, formatting, layout, ui, toolbar, document, content, writing, css, web design, ios, android, web app - css.gg Icons - CgFormatIndentDecrease - SVG | WEBP | PNG | JPG - Icon free download
CgFormatIndentDecrease
italic, text italic, italics, font style, typography, slanted text, emphasis, text formatting, editor, rich text, word processor, markdown, ui button, toolbar, document style, highlight, content styling, writing tools - css.gg Icons - CgFormatItalic - SVG | WEBP | PNG | JPG - Icon free download
CgFormatItalic
slash, forward slash, divider, symbol, punctuation, editor, markdown, formatting, text symbol, ui button, rich text, document, content, separator, command hint - css.gg Icons - CgFormatSlash - SVG | WEBP | PNG | JPG - Icon free download
CgFormatSlash
text, font, type, typography, editor, formatting, text tools, content, writing, document, rich text, page layout, ui control, markdown, input, paragraph, headline, title - css.gg Icons - CgFormatText - SVG | WEBP | PNG | JPG - Icon free download
CgFormatText
underline, format underline, text underline, formatting, text style, typography, editor, rich text, word processor, highlight, emphasis, ui text, button, toolbar action, markdown, html, css, web editor, wysiwyg, text decoration, headline, title formatting, emphasize, style control, design tool - css.gg Icons - CgFormatUnderline - SVG | WEBP | PNG | JPG - Icon free download
CgFormatUnderline
git, commit, git commit, checkpoint, version control, repo, repository, vcs, code change, snapshot, source control, dot, commit dot, development, devops, log, history, timeline, code review, engineering, toolbar, status, software - css.gg Icons - CgGitCommit - SVG | WEBP | PNG | JPG - Icon free download
CgGitCommit
hashtag, tag, trend, topic, social, post, category, label, keyword, instagram, twitter, x, tiktok, thread, channel, comments, filter, feed, metadata - css.gg Icons - CgHashtag - SVG | WEBP | PNG | JPG - Icon free download
CgHashtag
image, photo, picture, gallery, media, jpeg, png, upload image, insert image, preview, thumbnail, file image, visual, media asset, illustration, graphics, editor, image block, image placeholder, content creation - css.gg Icons - CgImage - SVG | WEBP | PNG | JPG - Icon free download
CgImage
picture in picture, pip, inpicture, video overlay, mini player, floating window, media, video, picture frame, windowed mode, pop out, preview window, multitasking, pip mode, player control, video sidebar, video docked, overlay window - css.gg Icons - CgInpicture - SVG | WEBP | PNG | JPG - Icon free download
CgInpicture
instagram, social, brand, ig, photo, camera, share, social media, stories, reels, followers, profile, feed, influencer, marketing, community, logo, app icon - css.gg Icons - CgInstagram - SVG | WEBP | PNG | JPG - Icon free download
CgInstagram
layout, pin, pinned, sticky, bookmark, save, remember, pinboard, priority, flag item, highlight, mark, ui pin, dashboard pin, fixed position, organize - css.gg Icons - CgLayoutPin - SVG | WEBP | PNG | JPG - Icon free download
CgLayoutPin
load, loadbar, sound, audio, buffering, playback, media, music player, podcast, streaming, upload, audio upload, progress, timeline, scrubbing, equalizer, playback indicator, buffer indicator, media control, visual feedback, ux, web ui, mobile ui, timeline scrub, encoding, sound processing, player ui, audio status, loading state - css.gg Icons - CgLoadbarSound - SVG | WEBP | PNG | JPG - Icon free download
CgLoadbarSound
loupe, search, magnifier, zoom, find, inspect, lookup, focus, search tool, spotlight, detect, scan, ui search, header search, sidebar tool, magnifying glass, highlight, filter, explore, browser search, lookup function, analysis tool, material style, ios search, android search - css.gg Icons - CgLoupe - SVG | WEBP | PNG | JPG - Icon free download
CgLoupe
monday, day, weekday, calendar, date, schedule, planner, workweek, task, agenda, timeline, events, reminder, organize, office, productivity, ui calendar, workday, week start - css.gg Icons - CgMonday - SVG | WEBP | PNG | JPG - Icon free download
CgMonday
music speaker, speaker, audio device, sound output, loudspeaker, woofer, music, media, sound system, audio player, volume device, home audio, bluetooth speaker, sound icon, music hardware, studio monitor, ui icon, material, ios, android - css.gg Icons - CgMusicSpeaker - SVG | WEBP | PNG | JPG - Icon free download
CgMusicSpeaker
music, audio, sound, melody, track, song, playlist, music icon, media, music library, music app, sound symbol, music control, music feature, entertainment, composer, recording, tone, beat, ui icon, material, ios, android - css.gg Icons - CgMusic - SVG | WEBP | PNG | JPG - Icon free download
CgMusic
pexels, brand, photo stock, stock images, media library, gallery, photos, image asset, creative commons, photography, pictures, content, visuals, media, download, upload, share, browser, portfolio, designer, editor, creative, resource, image manager - css.gg Icons - CgPexels - SVG | WEBP | PNG | JPG - Icon free download
CgPexels
photo scan, scan, camera, photo, image scan, scanner, qr scan, document scan, capture, camera app, editor, media, picture, frame, detect, analysis, barcode, vision, preview, ui action, toolbar, import - css.gg Icons - CgPhotoscan - SVG | WEBP | PNG | JPG - Icon free download
CgPhotoscan
pin, pin alt, marker, location, pointer, place, map pin, save, bookmark, note, tag, highlight, flag, position, point, drop pin, organize, plan, ui, task, reminder - css.gg Icons - CgPinAlt - SVG | WEBP | PNG | JPG - Icon free download
CgPinAlt
pin bottom, pin, marker, location, map pin, position bottom, anchor, fixed bottom, ui element, place, pointer, organize, plan, tag, bookmark, highlight, drop pin - css.gg Icons - CgPinBottom - SVG | WEBP | PNG | JPG - Icon free download
CgPinBottom
pin top, pin, marker, location, place, anchor top, map pin, pointer, bookmark, fixed top, sticky, ui element, tag, highlight, note, organize, task - css.gg Icons - CgPinTop - SVG | WEBP | PNG | JPG - Icon free download
CgPinTop
pin, marker, map pin, location, point, place, tag, bookmark, save, note, highlight, pointer, organize, task, reminder, sticky, ui button, layout - css.gg Icons - CgPin - SVG | WEBP | PNG | JPG - Icon free download
CgPin
play backwards, rewind, reverse, media, audio, video, controller, skip back, back, previous, play control, multimedia, player, timeline, jump back, toolbar, button, ui control - css.gg Icons - CgPlayBackwards - SVG | WEBP | PNG | JPG - Icon free download
CgPlayBackwards
fast forward, forward, skip forward, media forward, play forward, next, jump, advance, media control, playback, video control, audio control, streaming, music, next track, seek, timeline, cta, toolbar action, ios, android, web ui - css.gg Icons - CgPlayForwards - SVG | WEBP | PNG | JPG - Icon free download
CgPlayForwards
play pause, pause toggle, playback control, pause, play, media, audio, video, music, player, toggle, control, transport, streaming, ui button, toolbar action, ios, android, web app, minimal, line icon, outline, playback ui - css.gg Icons - CgPlayPauseR - SVG | WEBP | PNG | JPG - Icon free download
CgPlayPauseR
play pause, pause toggle, playback control, media, audio, video, music, player, toggle, control, transport, streaming, ui, button, playback ui, switch, pause button, play button - css.gg Icons - CgPlayPause - SVG | WEBP | PNG | JPG - Icon free download
CgPlayPause
next track, skip forward, track next, next, media, audio, video, music, player, playlist, navigate forward, streaming, line icon, outline, transport, ui button - css.gg Icons - CgPlayTrackNextO - SVG | WEBP | PNG | JPG - Icon free download
CgPlayTrackNextO
next track, skip, skip forward, track next, media, player, audio, video, playlist, transport control, ui button, navigate, forward - css.gg Icons - CgPlayTrackNext - SVG | WEBP | PNG | JPG - Icon free download
CgPlayTrackNext
previous track, track prev, skip backward, playlist back, media, audio, video, player, rewind, navigate back, line icon, transport, toolbar action - css.gg Icons - CgPlayTrackPrevR - SVG | WEBP | PNG | JPG - Icon free download
CgPlayTrackPrevR
play previous, track prev, previous, back, rewind, media, audio, video, player, controls, skip back, music, playlist, navigation, toolbar, button, ui, ios, android, web player, seek, media action, hover state, active state - css.gg Icons - CgPlayTrackPrev - SVG | WEBP | PNG | JPG - Icon free download
CgPlayTrackPrev
polaroid, photo, instant photo, camera, image, snapshot, picture frame, gallery, album, media, photography, retro, vintage, print, capture, creative, ui, thumbnail - css.gg Icons - CgPolaroid - SVG | WEBP | PNG | JPG - Icon free download
CgPolaroid
read, reading, open document, text, article, story, content viewer, file view, knowledge, education, learning, document access, blog, news, ui action, open file, ios, android, toolbar action, sidebar link - css.gg Icons - CgRead - SVG | WEBP | PNG | JPG - Icon free download
CgRead
record, recording, media, audio, video, mic, capture, start recording, button, red dot, ui control, media tool, screen record, voice memo, content creation, editor, streaming, timeline, media panel, android, ios - css.gg Icons - CgRecord - SVG | WEBP | PNG | JPG - Icon free download
CgRecord
redo, repeat, forward action, restore, reapply, edit, history, action step, ui control, toolbar button, editor tool, timeline, undo redo, workflow, command, android, ios, cursor action, shortcut - css.gg Icons - CgRedo - SVG | WEBP | PNG | JPG - Icon free download
CgRedo
remote, controller, remote control, iot, device, media, tv remote, smart home, automation, bluetooth, signal, infrared, control panel, electronics, settings, input device, android, ios, ui control - css.gg Icons - CgRemote - SVG | WEBP | PNG | JPG - Icon free download
CgRemote
scroll horizontal, horizontal scroll, scroll h, pan horizontal, drag, swipe, gesture, carousel, slider, timeline, movement, viewport, overflow, content navigation, ui control, arrows, scroll bar, touch interaction - css.gg Icons - CgScrollH - SVG | WEBP | PNG | JPG - Icon free download
CgScrollH
search found, result found, found, match, magnifier, magnifying glass, lookup, filter result, query match, search success, discovery, locate, find, highlight, ui search, navigation tool, lookup engine, content search, data search - css.gg Icons - CgSearchFound - SVG | WEBP | PNG | JPG - Icon free download
CgSearchFound
spinner, spinner two, loader, loading, progress, wait, buffering, activity, loop, rotation, reload, refresh, indicator, async, processing, status icon, ui spinner, modern ui, minimal loader, css gg - css.gg Icons - CgSpinnerTwo - SVG | WEBP | PNG | JPG - Icon free download
CgSpinnerTwo
spinner, loader, loading, progress, busy, refresh, cycle, rotate, waiting, indicator, processing, real time, ui spinner, minimal loader, clean ui, async, activity, css gg - css.gg Icons - CgSpinner - SVG | WEBP | PNG | JPG - Icon free download
CgSpinner
square, shape, box, container, geometry, tile, block, outline square, button shape, component, placeholder, grid, layout tool, minimal shape, design element, symbol, css gg - css.gg Icons - CgSquare - SVG | WEBP | PNG | JPG - Icon free download
CgSquare
stack, layers, pile, documents, server stack, cloud layers, multi layer, tier, architecture, backend, infrastructure, collection, nested items, data grouping, layered ui, css gg - css.gg Icons - CgStack - SVG | WEBP | PNG | JPG - Icon free download
CgStack
stark, logo inspired, symbol, mark, emblem, minimal icon, decorative, branding element, badge, abstract shape, sharp edges, graphic symbol, css gg - css.gg Icons - CgStark - SVG | WEBP | PNG | JPG - Icon free download
CgStark
stopwatch, timer, time, countdown, chronometer, track time, measure time, clock, interval, productivity, fitness timer, schedule, performance, laps, ui time, css gg - css.gg Icons - CgStopwatch - SVG | WEBP | PNG | JPG - Icon free download
CgStopwatch
stories, story, media, social story, highlight, timeline, content, reels, shorts, status update, photo story, video story, feed, carousel, social ui, css gg - css.gg Icons - CgStories - SVG | WEBP | PNG | JPG - Icon free download
CgStories
studio, creative, editing, workspace, media production, design studio, content creation, creative suite, film, audio, video, art tools, digital studio, creator, css gg - css.gg Icons - CgStudio - SVG | WEBP | PNG | JPG - Icon free download
CgStudio
style, styling, appearance, theme, customize, ui style, palette, design system, visual settings, decor, look and feel, formatting, editor, css gg - css.gg Icons - CgStyle - SVG | WEBP | PNG | JPG - Icon free download
CgStyle
sun, sunny, brightness, daylight, weather, light mode, theme, environment, warmth, sun icon, solar, day, clear sky, ui brightness, css gg - css.gg Icons - CgSun - SVG | WEBP | PNG | JPG - Icon free download
CgSun
time, clock, hour, timer, schedule, duration, countdown, moment, alarm, reminder, timeline, clock face, time tracking, productivity, work timer, hours, time indicator - css.gg Icons - CgTime - SVG | WEBP | PNG | JPG - Icon free download
CgTime
timelapse, time, progress, speed, fast forward, interval, camera, photography, video, recording, motion, timeline, animation, effect, time flow, visual effect, media tool - css.gg Icons - CgTimelapse - SVG | WEBP | PNG | JPG - Icon free download
CgTimelapse
today, calendar, date, current day, schedule, planner, agenda, day view, events, reminder, task list, daily plan, timeline, appointment, ui element, navigation, minimal icon, outline style - css.gg Icons - CgToday - SVG | WEBP | PNG | JPG - Icon free download
CgToday
track, tracking, follow, monitor, path, route, navigation, delivery status, shipment, progress, timeline, transport, gps track, location path, logistics, route progress, map planning, status flow, journey, movement tracking, workflow track, progress route - css.gg Icons - CgTrack - SVG | WEBP | PNG | JPG - Icon free download
CgTrack
tv, television, screen, display, monitor, video, stream, broadcast, media, entertainment, show, movie, series, watch, smart tv, home theater, device, program, display unit, electronics, output device - css.gg Icons - CgTv - SVG | WEBP | PNG | JPG - Icon free download
CgTv
twitter, brand, social, tweet, bird, microblog, social network, post, share, communication, x platform, follow, engagement, viral, social media, profile, feed, timeline, hashtags, community, marketing, promotion - css.gg Icons - CgTwitter - SVG | WEBP | PNG | JPG - Icon free download
CgTwitter
view day, day view, calendar, schedule, agenda, daily layout, planner, events, time management, timeline, ui view, organizer, appointment, day mode, date view, productivity tools - css.gg Icons - CgViewDay - SVG | WEBP | PNG | JPG - Icon free download
CgViewDay
vinyl, record, disc, music, audio, lp, retro, album, sound, playlist, turntable, media, analog, classic music, music collection, record player, audio library - css.gg Icons - CgVinyl - SVG | WEBP | PNG | JPG - Icon free download
CgVinyl
youtube, yt, video, streaming, brand, logo, play button, channel, creator, subscribe, social media, content, vlog, livestream, influencer, marketing, promotion - css.gg Icons - CgYoutube - SVG | WEBP | PNG | JPG - Icon free download
CgYoutube
bookmark check, bookmark, check, confirm, saved, verify, tick, indicator, status, success, list, reading list, favorites, starred, highlight, flag, toolbar action, menu item, ios, android, web app, ui element, selection - Circum Icons - CiBookmarkCheck - SVG | WEBP | PNG | JPG - Icon free download
CiBookmarkCheck
bookmark plus, bookmark, add bookmark, save, plus, new, add, favorites, reading list, mark, highlight, flag, ui action, toolbar, menu item, ios, android, web ui, list management - Circum Icons - CiBookmarkPlus - SVG | WEBP | PNG | JPG - Icon free download
CiBookmarkPlus
bookmark, marker, flag, save, favorites, reading list, highlight, tag, label, placeholder, ui element, iconography, ios, android, web app, sidebar, menu item - Circum Icons - CiBookmark - SVG | WEBP | PNG | JPG - Icon free download
CiBookmark
calendar date, calendar, date, event, schedule, time, appointment, deadline, planner, task, meeting, booking, reminder, organize, timeline, day view, monthly view, ui calendar, datepicker, form input, agenda - Circum Icons - CiCalendarDate - SVG | WEBP | PNG | JPG - Icon free download
CiCalendarDate
calendar, date, schedule, event, planner, time management, appointment, monthly calendar, yearly calendar, timeline, reminder, task, booking, agenda, ui calendar, datepicker, calendar icon, management, organize, work planning - Circum Icons - CiCalendar - SVG | WEBP | PNG | JPG - Icon free download
CiCalendar
camera, photo, photography, capture, take picture, snapshot, media, lens, shoot, image capture, content creation, gallery, photo upload, camera app, multimedia, record, visual content, mobile camera, ui toolbar, profile photo - Circum Icons - CiCamera - SVG | WEBP | PNG | JPG - Icon free download
CiCamera
circle chevron left, chevron left, arrow left, navigate left, previous, back, go back, slide left, carousel, pagination, rewind, ui arrow, directional control, minimal, line icon, ios, android - Circum Icons - CiCircleChevLeft - SVG | WEBP | PNG | JPG - Icon free download
CiCircleChevLeft
circle chevron right, chevron right, arrow right, navigate right, next, forward, slide right, carousel, pagination, fast forward, ui arrow, directional control, minimal, line icon, ios, android - Circum Icons - CiCircleChevRight - SVG | WEBP | PNG | JPG - Icon free download
CiCircleChevRight
crop, image crop, edit, photo edit, resize, trim, cut, design tool, adjustment, editor, media, toolbar, graphics, aspect ratio, composition, visual editing, photo tool, ui control - Circum Icons - CiCrop - SVG | WEBP | PNG | JPG - Icon free download
CiCrop
hashtag, #, tag, trend, topic, social media, label, keyword, category, post, comment, feed, discover, explore, search tag, metadata, social tag, marketing, campaign, topic marker, instagram, twitter, tiktok, seo tag, content sorting, discussion, thread - Circum Icons - CiHashtag - SVG | WEBP | PNG | JPG - Icon free download
CiHashtag
headphones, audio, music, listen, sound, media, earphones, headset, song, playlist, podcast, volume, streaming, entertainment, device, wearable, gaming, bass, audio gear, speaker, sound quality, music app, audio control, relax, studio, dj, ios, android, material - Circum Icons - CiHeadphones - SVG | WEBP | PNG | JPG - Icon free download
CiHeadphones
indent, text indent, format, spacing, paragraph, editor, rich text, layout, alignment, increase indent, decrease indent, writing, document, content, typography, ui control, toolbar action, markdown, code editor, word processor, text styling - Circum Icons - CiIndent - SVG | WEBP | PNG | JPG - Icon free download
CiIndent
instagram, brand, social media, photo, camera, share, ig, stories, reels, profile, network, community, influencer, media post, social icon, logo, social button, mobile app, messaging, photography app, story sharing - Circum Icons - CiInstagram - SVG | WEBP | PNG | JPG - Icon free download
CiInstagram
music note, note, music, audio, sound, melody, song, track, playlist, tune, music player, mp3, media, soundtrack, instrument, beat, rhythm, entertainment, listen, audio control, music app - Circum Icons - CiMusicNote1 - SVG | WEBP | PNG | JPG - Icon free download
CiMusicNote1
music note, note, music, audio, sound, melody, song, track, playlist, tune, music player, mp3, media, soundtrack, instrument, beat, rhythm, entertainment, listen, audio control, music app - Circum Icons - CiMusicNote1 - SVG | WEBP | PNG | JPG - Icon free download
CiMusicNote1
read, reading, book, open book, article, document, study, education, learn, literature, knowledge, pages, content, text, viewer, book icon, article icon, documentation, library, bookmark, ui element, content view - Circum Icons - CiRead - SVG | WEBP | PNG | JPG - Icon free download
CiRead
slider, horizontal slider, control bar, adjust, range input, seek bar, volume control, media control, settings, ui element, toolbar, controller, form input, progress, timeline, scrubber, user control - Circum Icons - CiSliderHorizontal - SVG | WEBP | PNG | JPG - Icon free download
CiSliderHorizontal
slider, vertical slider, control bar, adjust, range input, volume control, sound level, settings, ui component, toolbar, controller, scrubber, progress, timeline, user control - Circum Icons - CiSliderVertical - SVG | WEBP | PNG | JPG - Icon free download
CiSliderVertical
star, favorite, rate, rating, bookmark, highlight, featured, mark, priority, five star, ui star, review, feedback, favorite item, wishlist, importance, badge star, achievement, minimal star, premium - Circum Icons - CiStar - SVG | WEBP | PNG | JPG - Icon free download
CiStar
text align left, align left, left alignment, text, paragraph, editor, document, formatting, typography, layout, ui, toolbar, content, writing, article, note, markdown, wysiwyg, design tool, text block, header, footer, sidebar, alignment control, left justified, text layout, word processor - Circum Icons - CiTextAlignLeft - SVG | WEBP | PNG | JPG - Icon free download
CiTextAlignLeft
text align right, align right, right alignment, text, paragraph, editor, document, formatting, typography, layout, ui, toolbar, content, design tool, writing, markdown, wysiwyg, right justified, text layout, alignment control, word processor, text block - Circum Icons - CiTextAlignRight - SVG | WEBP | PNG | JPG - Icon free download
CiTextAlignRight
text, typography, letter, font, characters, editor, input, type tool, writing, document, content, markdown, wysiwyg, text block, headline, paragraph, ui control, button, toolbar, design tool, label, title, subtitle - Circum Icons - CiText - SVG | WEBP | PNG | JPG - Icon free download
CiText
twitter, brand, social media, tweet, x, microblog, share, communication, community, network, promotion, marketing, social platform, social network, social icon, post, follow, profile, hashtag, timeline - Circum Icons - CiTwitter - SVG | WEBP | PNG | JPG - Icon free download
CiTwitter
unread, message unread, new mail, notification, badge, inbox, email, chat, status, alert, new item, pending, highlight, communication, update, bubble, indicator, toolbar, header - Circum Icons - CiUnread - SVG | WEBP | PNG | JPG - Icon free download
CiUnread
video off, camera off, disable video, mute video, call, meeting, conference, webcam, streaming, communication, media, status, indicator, toggle, privacy, recording off, toolbar action, ui control - Circum Icons - CiVideoOff - SVG | WEBP | PNG | JPG - Icon free download
CiVideoOff
video on, camera on, enable video, webcam, streaming, live, recording, conference, call, communication, media, toggle, status, video feed, ui control, toolbar, meeting, capture - Circum Icons - CiVideoOn - SVG | WEBP | PNG | JPG - Icon free download
CiVideoOn
view timeline, timeline, progress, milestones, history, chronology, workflow, project timeline, events, task progression, gantt-like, planning, roadmap, schedule, sequence, time flow, ui component, storyline, tracking - Circum Icons - CiViewTimeline - SVG | WEBP | PNG | JPG - Icon free download
CiViewTimeline
youtube, brand, video, youtube logo, youtube icon, subscribe, channel, play, streaming, vlogger, content creator, youtuber, social media, embed, share, header, footer, link, cta, marketing, promotion, media, platform, playlist, live stream, video gallery, watch - Circum Icons - CiYoutube - SVG | WEBP | PNG | JPG - Icon free download
CiYoutube
celluloid, film, movie, video production, cinema, film reel, media, editing, video tools, creative suite, storytelling, motion picture, old film, analog film, reel icon, entertainment, studio, filmmaking, post production - Devicons - DiCelluloid - SVG | WEBP | PNG | JPG - Icon free download
DiCelluloid
hackernews, hn, news, tech news, developer news, programming news, community, blog, discussion, feed, aggregator, open source, brand, logo, social platform, tech community, sidebar link, header link, navigation - Devicons - DiHackernews - SVG | WEBP | PNG | JPG - Icon free download
DiHackernews
html5, multimedia, audio, video, media api, streaming, player, frontend, browser tech, web apps, dev, developer tools, logo, brand, interactive, content - Devicons - DiHtml5Multimedia - SVG | WEBP | PNG | JPG - Icon free download
DiHtml5Multimedia
jira, atlassian, project management, scrum, agile, kanban, tickets, issues, backlog, sprint, workflow, devops, collaboration, team board, product planning, task tracking, work items, epic, story, bug tracking, enterprise, productivity, dashboard - Devicons - DiJira - SVG | WEBP | PNG | JPG - Icon free download
DiJira
adn, app dot net, social network, microblogging, communication, brand, logo, messaging, timeline, community, developer platform, api, social media, tech - Font Awesome 5 - FaAdn - SVG | WEBP | PNG | JPG - Icon free download
FaAdn
adversal, ad network, advertising, marketing, brand, logo, adtech, publisher, monetization, traffic, campaigns, display ads, programmatic, media, digital marketing - Font Awesome 5 - FaAdversal - SVG | WEBP | PNG | JPG - Icon free download
FaAdversal
artstation, art, digital art, 3d modeling, artists, portfolio, creative community, game art, concept art, illustration, design, branding, media, creative software, gallery, showcase, designer platform, button, profile, badge - Font Awesome 5 - FaArtstation - SVG | WEBP | PNG | JPG - Icon free download
FaArtstation
audible, audiobooks, audio, books, podcasts, listening, streaming, media, entertainment, amazon, subscription, audio app, brand icon, sound, library, digital content, storytelling, badge, button - Font Awesome 5 - FaAudible - SVG | WEBP | PNG | JPG - Icon free download
FaAudible
bandcamp, brand, music, audio, streaming, artist platform, indie music, album, song, playlist, media, entertainment, publisher, creative, upload, share, digital store, badge, logo, icon, web, app, social media - Font Awesome 5 - FaBandcamp - SVG | WEBP | PNG | JPG - Icon free download
FaBandcamp
bity, brand, social, media, platform, profile, logo, badge, communication, messaging, creator, community, content, digital, network, web, app - Font Awesome 5 - FaBity - SVG | WEBP | PNG | JPG - Icon free download
FaBity
Tags
mediavideouiaudioplayercontentbuttoncontroltoolbareditordocumentfileoutlinemusicphotofilledhighlightplaylisttimelineskipimagetextiosandroidplaybackbrandgalleryrecordcirclecameranextforwardnavigationbadgesoundlayoutpicturetrackrewindpreviousplaylogowritingsocialentertainmentlabelcapturesharestreamingnotemoviewebcalendarschedulestartstreamsidebarformattagplannerstoplibraryuploadbookmarkrecordingfilmdevicecarouseltypographymultimediafeedbackbackwardpausedisplaysongindicatorclipformattingdatealbumplatformui-controldesignuxarrowstarbloglistmarkdownearmarkdownloadmarkercontrolscollectionsliderarticlepostprofilecommunityqualitydashboardfavoritephotographymarketingparagraphagendalineeventratingshootroundheaderofficechevron