CRUDIOS
track, tracking, follow, monitor, path, route, navigation, delivery status, shipment, progress, timeline, transport, gps track, location path, logistics, route progress, map planning, status flow, journey, movement tracking, workflow track, progress route - css.gg Icons - CgTrack - SVG | WEBP | PNG | JPG - Icon free download
cg/CgTrack

cg/CgTrack (css.gg Icons)

VS Code
1import { CgTrack } from "react-icons/cg";
2
3export default function Page(){
4  return <div><CgTrack/></div>
5}
Click To Copy (Free To Use)
Description
Line track icon representing routes or progress paths; useful for delivery status pages, logistics dashboards, navigation apps, workflow monitoring, and route visualization components.
Tags
tracktrackingfollowmonitorpathroutenavigationdelivery statusshipmentprogresstimelinetransportgps tracklocation pathlogisticsroute progressmap planningstatus flowjourneymovement trackingworkflow trackprogress route
Categories
navigationtransportationstatusanalyticstrackingdeliverymapslogistics
WEBP Download (256px)Customize & Download (HD)
Related Icons
audio, sound, music, volume, media, speaker, track - Ant Design Icons - AiFillAudio - SVG | WEBP | PNG | JPG - Icon free download
AiFillAudio
calendar, date, schedule, event, planner, timeline - Ant Design Icons - AiFillCalendar - SVG | WEBP | PNG | JPG - Icon free download
AiFillCalendar
car, vehicle, auto, transport, drive, travel - Ant Design Icons - AiFillCar - SVG | WEBP | PNG | JPG - Icon free download
AiFillCar
container, box, package, storage, logistics, cargo - Ant Design Icons - AiFillContainer - SVG | WEBP | PNG | JPG - Icon free download
AiFillContainer
dashboard, panel, metrics, overview, stats, control, monitor - Ant Design Icons - AiFillDashboard - SVG | WEBP | PNG | JPG - Icon free download
AiFillDashboard
truck, delivery, shipping, transport, cargo, logistics - Ant Design Icons - AiFillTruck - SVG | WEBP | PNG | JPG - Icon free download
AiFillTruck
car, vehicle, auto, transport, drive, travel, ride - Ant Design Icons - AiOutlineCar - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCar
chrome, google, browser, web, internet, brand, navigation - Ant Design Icons - AiOutlineChrome - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineChrome
desktop, monitor, screen, pc, display, computer, workstation - Ant Design Icons - AiOutlineDesktop - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDesktop
double-left, chevron, arrow, previous, back, navigation - Ant Design Icons - AiOutlineDoubleLeft - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDoubleLeft
double-right, chevron, arrow, next, forward, navigation - Ant Design Icons - AiOutlineDoubleRight - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDoubleRight
down, circle, arrow, scroll, dropdown, navigation - Ant Design Icons - AiOutlineDownCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDownCircle
down, square, arrow, dropdown, scroll, navigation - Ant Design Icons - AiOutlineDownSquare - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDownSquare
down, arrow, scroll, dropdown, direction, navigation - Ant Design Icons - AiOutlineDown - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDown
fork, branch, split, code, version, path, git - Ant Design Icons - AiOutlineFork - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFork
history, recent, clock, past, log, timeline, records - Ant Design Icons - AiOutlineHistory - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineHistory
left, circle, arrow, back, navigation, previous - Ant Design Icons - AiOutlineLeftCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLeftCircle
left, square, arrow, back, navigation, previous - Ant Design Icons - AiOutlineLeftSquare - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLeftSquare
left, arrow, previous, back, navigation, direction - Ant Design Icons - AiOutlineLeft - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLeft
link, url, chain, hyperlink, connect, anchor, navigation - Ant Design Icons - AiOutlineLink - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLink
loading, spinner, progress, wait, busy, pending, rotate - Ant Design Icons - AiOutlineLoading3Quarters - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLoading3Quarters
loading, spinner, progress, wait, busy, pending, refresh - Ant Design Icons - AiOutlineLoading - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLoading
menu, fold, collapse, sidebar, toggle, ui, navigation - Ant Design Icons - AiOutlineMenuFold - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMenuFold
menu, unfold, expand, sidebar, toggle, ui, navigation - Ant Design Icons - AiOutlineMenuUnfold - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMenuUnfold
monitor, screen, display, desktop, computer, view, window - Ant Design Icons - AiOutlineMonitor - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMonitor
right, circle, arrow, next, forward, navigation, move - Ant Design Icons - AiOutlineRightCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineRightCircle
right, square, arrow, next, forward, navigation, button - Ant Design Icons - AiOutlineRightSquare - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineRightSquare
swap, right, arrow, exchange, switch, direction, navigation - Ant Design Icons - AiOutlineSwapRight - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSwapRight
truck, delivery, shipping, logistics, vehicle, transport, cargo - Ant Design Icons - AiOutlineTruck - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTruck
car, automobile, vehicle, transport, drive, rental, garage, travel - Ant Design Icons - AiTwotoneCar - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCar
compass, direction, navigation, location, maps, explore, interface, tool - Ant Design Icons - AiTwotoneCompass - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCompass
left, arrow, circle, previous, back, navigation, direction - Ant Design Icons - AiTwotoneLeftCircle - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneLeftCircle
left, arrow, square, previous, back, navigation, direction - Ant Design Icons - AiTwotoneLeftSquare - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneLeftSquare
arrow, back, previous, navigation, left, return - BoxIcons - BiArrowBack - SVG | WEBP | PNG | JPG - Icon free download
BiArrowBack
arrow, from-bottom, up, incoming, navigation, direction - BoxIcons - BiArrowFromBottom - SVG | WEBP | PNG | JPG - Icon free download
BiArrowFromBottom
arrow, from-left, right, incoming, navigation, direction - BoxIcons - BiArrowFromLeft - SVG | WEBP | PNG | JPG - Icon free download
BiArrowFromLeft
arrow, from-right, left, incoming, navigation, direction - BoxIcons - BiArrowFromRight - SVG | WEBP | PNG | JPG - Icon free download
BiArrowFromRight
arrow, from-top, down, incoming, navigation, direction - BoxIcons - BiArrowFromTop - SVG | WEBP | PNG | JPG - Icon free download
BiArrowFromTop
arrow, to-bottom, down, direction, navigation, move - BoxIcons - BiArrowToBottom - SVG | WEBP | PNG | JPG - Icon free download
BiArrowToBottom
arrow, to-left, left, navigation, direction, move - BoxIcons - BiArrowToLeft - SVG | WEBP | PNG | JPG - Icon free download
BiArrowToLeft
arrow, to-right, right, navigation, direction, move - BoxIcons - BiArrowToRight - SVG | WEBP | PNG | JPG - Icon free download
BiArrowToRight
arrow, to-top, up, navigation, direction, move - BoxIcons - BiArrowToTop - SVG | WEBP | PNG | JPG - Icon free download
BiArrowToTop
buoy, float, water, rescue, marine, safety, navigation - BoxIcons - BiBuoy - SVG | WEBP | PNG | JPG - Icon free download
BiBuoy
bus, school, school-bus, vehicle, transport, ride, student - BoxIcons - BiBusSchool - SVG | WEBP | PNG | JPG - Icon free download
BiBusSchool
bus, vehicle, public, transport, travel, ride, commute - BoxIcons - BiBus - SVG | WEBP | PNG | JPG - Icon free download
BiBus
cablecar, cable-car, transport, mountain, ride, travel, lift - BoxIcons - BiCableCar - SVG | WEBP | PNG | JPG - Icon free download
BiCableCar
camera, home, security, cctv, monitor, surveillance, video - BoxIcons - BiCameraHome - SVG | WEBP | PNG | JPG - Icon free download
BiCameraHome
car, vehicle, automobile, drive, transport, travel - BoxIcons - BiCar - SVG | WEBP | PNG | JPG - Icon free download
BiCar
cctv, camera, surveillance, monitor, security, watch - BoxIcons - BiCctv - SVG | WEBP | PNG | JPG - Icon free download
BiCctv
compass, direction, navigation, map, travel, guide, orientation - BoxIcons - BiCompass - SVG | WEBP | PNG | JPG - Icon free download
BiCompass
current, location, gps, position, map, locate, tracking - BoxIcons - BiCurrentLocation - SVG | WEBP | PNG | JPG - Icon free download
BiCurrentLocation
desktop, monitor, screen, computer, pc, workstation, device - BoxIcons - BiDesktop - SVG | WEBP | PNG | JPG - Icon free download
BiDesktop
devices, screens, monitor, tablet, phone, electronics, hardware - BoxIcons - BiDevices - SVG | WEBP | PNG | JPG - Icon free download
BiDevices
directions, route, path, guide, navigation, map - BoxIcons - BiDirections - SVG | WEBP | PNG | JPG - Icon free download
BiDirections
door, open, entry, exit, access, navigation - BoxIcons - BiDoorOpen - SVG | WEBP | PNG | JPG - Icon free download
BiDoorOpen
exit, logout, leave, close, back, navigation, ui - BoxIcons - BiExit - SVG | WEBP | PNG | JPG - Icon free download
BiExit
history, clock, past, recent, timeline, activity - BoxIcons - BiHistory - SVG | WEBP | PNG | JPG - Icon free download
BiHistory
home, house, alt, main, navigation, landing - BoxIcons - BiHomeAlt - SVG | WEBP | PNG | JPG - Icon free download
BiHomeAlt
home, circle, house, main, navigation, start - BoxIcons - BiHomeCircle - SVG | WEBP | PNG | JPG - Icon free download
BiHomeCircle
home, house, main, navigation, landing, start - BoxIcons - BiHome - SVG | WEBP | PNG | JPG - Icon free download
BiHome
left, arrow, back, navigation, previous, direction, pointer - BoxIcons - BiLeftArrow - SVG | WEBP | PNG | JPG - Icon free download
BiLeftArrow
loader, loading, spinner, progress, wait, alt, busy - BoxIcons - BiLoaderAlt - SVG | WEBP | PNG | JPG - Icon free download
BiLoaderAlt
loader, circle, loading, spinner, wait, progress, busy - BoxIcons - BiLoaderCircle - SVG | WEBP | PNG | JPG - Icon free download
BiLoaderCircle
loader, loading, spinner, progress, wait, animation, busy - BoxIcons - BiLoader - SVG | WEBP | PNG | JPG - Icon free download
BiLoader
map, alt, navigation, location, geo, route - BoxIcons - BiMapAlt - SVG | WEBP | PNG | JPG - Icon free download
BiMapAlt
map, geo, navigation, location, route, atlas - BoxIcons - BiMap - SVG | WEBP | PNG | JPG - Icon free download
BiMap
menu, hamburger, left, navigation, sidebar, toggle - BoxIcons - BiMenuAltLeft - SVG | WEBP | PNG | JPG - Icon free download
BiMenuAltLeft
menu, hamburger, right, navigation, sidebar, toggle - BoxIcons - BiMenuAltRight - SVG | WEBP | PNG | JPG - Icon free download
BiMenuAltRight
menu, hamburger, navigation, list, toggle, toolbar - BoxIcons - BiMenu - SVG | WEBP | PNG | JPG - Icon free download
BiMenu
mouse, alt, pointer, computer, input, device, navigation - BoxIcons - BiMouseAlt - SVG | WEBP | PNG | JPG - Icon free download
BiMouseAlt
mouse, computer, pointer, input, device, navigation, cursor - BoxIcons - BiMouse - SVG | WEBP | PNG | JPG - Icon free download
BiMouse
navigation, compass, direction, map, location, pointer - BoxIcons - BiNavigation - SVG | WEBP | PNG | JPG - Icon free download
BiNavigation
package, box, parcel, shipping, delivery, logistics, product - BoxIcons - BiPackage - SVG | WEBP | PNG | JPG - Icon free download
BiPackage
pointer, cursor, click, select, arrow, navigation - BoxIcons - BiPointer - SVG | WEBP | PNG | JPG - Icon free download
BiPointer
pulse, heartbeat, monitor, vitals, health, signal - BoxIcons - BiPulse - SVG | WEBP | PNG | JPG - Icon free download
BiPulse
rfid, scan, tag, signal, wireless, chip, tracking - BoxIcons - BiRfid - SVG | WEBP | PNG | JPG - Icon free download
BiRfid
sidebar, menu, panel, layout, navigation, ui - BoxIcons - BiSidebar - SVG | WEBP | PNG | JPG - Icon free download
BiSidebar
sitemap, structure, tree, hierarchy, navigation, map - BoxIcons - BiSitemap - SVG | WEBP | PNG | JPG - Icon free download
BiSitemap
station, train, stop, transport, map, location - BoxIcons - BiStation - SVG | WEBP | PNG | JPG - Icon free download
BiStation
stopwatch, timer, clock, time, countdown, track - BoxIcons - BiStopwatch - SVG | WEBP | PNG | JPG - Icon free download
BiStopwatch
street, view, map, location, navigation, road - BoxIcons - BiStreetView - SVG | WEBP | PNG | JPG - Icon free download
BiStreetView
subdirectory, left, folder, files, navigate, path - BoxIcons - BiSubdirectoryLeft - SVG | WEBP | PNG | JPG - Icon free download
BiSubdirectoryLeft
subdirectory, right, folder, files, navigate, path - BoxIcons - BiSubdirectoryRight - SVG | WEBP | PNG | JPG - Icon free download
BiSubdirectoryRight
tab, panel, switch, navigation, ui, section - BoxIcons - BiTab - SVG | WEBP | PNG | JPG - Icon free download
BiTab
target, lock, focus, aim, tracking, precision - BoxIcons - BiTargetLock - SVG | WEBP | PNG | JPG - Icon free download
BiTargetLock
taxi, cab, car, transport, ride, vehicle, travel, pickup - BoxIcons - BiTaxi - SVG | WEBP | PNG | JPG - Icon free download
BiTaxi
timer, stopwatch, countdown, time, clock, track - BoxIcons - BiTimer - SVG | WEBP | PNG | JPG - Icon free download
BiTimer
train, rail, transport, travel, subway, metro, vehicle - BoxIcons - BiTrain - SVG | WEBP | PNG | JPG - Icon free download
BiTrain
trip, travel, journey, tour, vacation, route - BoxIcons - BiTrip - SVG | WEBP | PNG | JPG - Icon free download
BiTrip
tv, television, screen, display, monitor, media - BoxIcons - BiTv - SVG | WEBP | PNG | JPG - Icon free download
BiTv
world, globe, earth, global, international, map, navigation - BoxIcons - BiWorld - SVG | WEBP | PNG | JPG - Icon free download
BiWorld
ambulance, emergency, medical, transport, rescue, healthcare, sos - BoxIcons - BiSolidAmbulance - SVG | WEBP | PNG | JPG - Icon free download
BiSolidAmbulance
bus, school, school-bus, transport, vehicle, ride, commute - BoxIcons - BiSolidBusSchool - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBusSchool
bus, vehicle, transport, public, commute, travel, route - BoxIcons - BiSolidBus - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBus
cable-car, transport, lift, mountain, ride, tourism, travel - BoxIcons - BiSolidCableCar - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCableCar
calendar, week, weekly, planner, schedule, date, timeline - BoxIcons - BiSolidCalendarWeek - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCalendarWeek
camera, home, security, surveillance, monitor, cctv, smart-home - BoxIcons - BiSolidCameraHome - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCameraHome
car, vehicle, auto, transport, drive, travel - BoxIcons - BiSolidCar - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCar
caret, down, arrow, circle, dropdown, navigation, ui - BoxIcons - BiSolidCaretDownCircle - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCaretDownCircle
caret, down, arrow, square, dropdown, navigation, ui - BoxIcons - BiSolidCaretDownSquare - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCaretDownSquare
caret, left, arrow, circle, previous, navigation, ui - BoxIcons - BiSolidCaretLeftCircle - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCaretLeftCircle
caret, left, arrow, square, previous, navigation, ui - BoxIcons - BiSolidCaretLeftSquare - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCaretLeftSquare
caret, right, arrow, circle, next, navigation, ui - BoxIcons - BiSolidCaretRightCircle - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCaretRightCircle
caret, right, arrow, square, next, navigation, ui - BoxIcons - BiSolidCaretRightSquare - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCaretRightSquare
caret, up, arrow, circle, scroll, navigation, ui - BoxIcons - BiSolidCaretUpCircle - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCaretUpCircle
caret, up, arrow, square, scroll, navigation, ui - BoxIcons - BiSolidCaretUpSquare - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCaretUpSquare
devices, monitor, tablet, phone, electronics, screens - BoxIcons - BiSolidDevices - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDevices
directions, arrows, navigate, path, route, location - BoxIcons - BiSolidDirections - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDirections
down, arrow, square, direction, navigation, scroll - BoxIcons - BiSolidDownArrowSquare - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDownArrowSquare
home, house, main, start, homepage, navigation - BoxIcons - BiSolidHomeAlt2 - SVG | WEBP | PNG | JPG - Icon free download
BiSolidHomeAlt2
home, circle, house, main, start, navigation - BoxIcons - BiSolidHomeCircle - SVG | WEBP | PNG | JPG - Icon free download
BiSolidHomeCircle
home, heart, favorite, house, love, navigation - BoxIcons - BiSolidHomeHeart - SVG | WEBP | PNG | JPG - Icon free download
BiSolidHomeHeart
home, smile, happy, house, positive, navigation - BoxIcons - BiSolidHomeSmile - SVG | WEBP | PNG | JPG - Icon free download
BiSolidHomeSmile
home, house, main, start, root, navigation - BoxIcons - BiSolidHome - SVG | WEBP | PNG | JPG - Icon free download
BiSolidHome
map, alt, navigation, route, location, guide - BoxIcons - BiSolidMapAlt - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMapAlt
map, navigation, route, area, location, guide - BoxIcons - BiSolidMap - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMap
navigation, location, direction, navigate, pointer, map, guide - BoxIcons - BiSolidNavigation - SVG | WEBP | PNG | JPG - Icon free download
BiSolidNavigation
package, parcel, box, delivery, shipping, logistics, cargo - BoxIcons - BiSolidPackage - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPackage
parking, car, vehicle, spot, location, garage, transport - BoxIcons - BiSolidParking - SVG | WEBP | PNG | JPG - Icon free download
BiSolidParking
pointer, cursor, arrow, select, click, hover, navigation - BoxIcons - BiSolidPointer - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPointer
taxi, cab, car, transport, ride, vehicle, travel - BoxIcons - BiSolidTaxi - SVG | WEBP | PNG | JPG - Icon free download
BiSolidTaxi
top, up, arrow, scroll, navigation, back, jump - BoxIcons - BiSolidToTop - SVG | WEBP | PNG | JPG - Icon free download
BiSolidToTop
train, rail, metro, transport, travel, public, vehicle - BoxIcons - BiSolidTrain - SVG | WEBP | PNG | JPG - Icon free download
BiSolidTrain
truck, delivery, shipping, cargo, logistics, transport - BoxIcons - BiSolidTruck - SVG | WEBP | PNG | JPG - Icon free download
BiSolidTruck
tv, television, screen, display, monitor, media - BoxIcons - BiSolidTv - SVG | WEBP | PNG | JPG - Icon free download
BiSolidTv
vector, design, graphics, shape, path, editor, tool, geometry - BoxIcons - BiSolidVector - SVG | WEBP | PNG | JPG - Icon free download
BiSolidVector
opera, browser, internet, web, navigation, app - BoxIcons - BiLogoOpera - SVG | WEBP | PNG | JPG - Icon free download
BiLogoOpera
pinterest, pin, social, media, share, follow - BoxIcons - BiLogoPinterest - SVG | WEBP | PNG | JPG - Icon free download
BiLogoPinterest
twitter, tweet, social, microblog, post, follow, network - BoxIcons - BiLogoTwitter - SVG | WEBP | PNG | JPG - Icon free download
BiLogoTwitter
airplane, plane, flight, travel, engine, air, transport, trip, journey - Bootstrap Icons - BsFillAirplaneEnginesFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillAirplaneEnginesFill
airplane, flight, travel, plane, transport, trip - Bootstrap Icons - BsFillAirplaneFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillAirplaneFill
bus, front, vehicle, transport, public, travel, commute, route - Bootstrap Icons - BsFillBusFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBusFrontFill
car, vehicle, front, auto, drive, transport, travel - Bootstrap Icons - BsFillCarFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCarFrontFill
clipboard, pulse, health, monitor, vitals, record, medical - Bootstrap Icons - BsFillClipboard2PulseFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillClipboard2PulseFill
compass, direction, navigation, explore, map, location - Bootstrap Icons - BsFillCompassFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillCompassFill
display, monitor, screen, desktop, computer, device - Bootstrap Icons - BsFillDisplayFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDisplayFill
displayport, port, connector, monitor, video, cable - Bootstrap Icons - BsFillDisplayportFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDisplayportFill
dpad, controller, game, direction pad, navigation, console - Bootstrap Icons - BsFillDpadFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDpadFill
ev, electric, vehicle, car, front, transport - Bootstrap Icons - BsFillEvFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillEvFrontFill
file, music, audio, sound, track, document - Bootstrap Icons - BsFillFileMusicFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillFileMusicFill
heart, pulse, heartbeat, health, medical, monitor - Bootstrap Icons - BsFillHeartPulseFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillHeartPulseFill
map, location, navigate, geo, travel, route, directions - Bootstrap Icons - BsFillMapFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMapFill
menu, app, grid, launcher, navigation, dashboard, options - Bootstrap Icons - BsFillMenuAppFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMenuAppFill
menu, button, options, toggle, ui, navigation, control - Bootstrap Icons - BsFillMenuButtonFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMenuButtonFill
rocket, takeoff, rocket-takeoff, launch, startup, boost, lift-off, growth, acceleration, space, mission, progress, speed - Bootstrap Icons - BsFillRocketTakeoffFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRocketTakeoffFill
rss, feed, news, subscription, blog, broadcast, signal, updates, syndication, reader, web-feed, follow - Bootstrap Icons - BsFillRssFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRssFill
search, heart, search-heart, love, favorite, find, lookup, discover, romance, wishlist, ui, button, icon, filter, explore, match, results, valentine, social, recommendation, navigation, toolbar, header, mobile - Bootstrap Icons - BsFillSearchHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSearchHeartFill
sign, dead-end, road, traffic, stop, barrier, navigation, map, warning, transport, directions, ui - Bootstrap Icons - BsFillSignDeadEndFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignDeadEndFill
sign, do-not-enter, stop, restricted, road, traffic, navigation, map, warning, ban, prohibited, transport, no-entry - Bootstrap Icons - BsFillSignDoNotEnterFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignDoNotEnterFill
sign, intersection, road, crossing, traffic, navigation, map, junction, transport, turn, directions, ui - Bootstrap Icons - BsFillSignIntersectionFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignIntersectionFill
sign, intersection-side, side-road, turn, road, traffic, navigation, map, transport, junction, directions - Bootstrap Icons - BsFillSignIntersectionSideFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignIntersectionSideFill
sign, intersection-t, t-junction, road, turn, traffic, navigation, map, transport, junction, directions - Bootstrap Icons - BsFillSignIntersectionTFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignIntersectionTFill
intersection, y-intersection, road, traffic, turn, junction, merge, route, direction, map, wayfinding, street, highway, sign, warning, safety, driving, vehicle, navigation, indicator, ui-icon - Bootstrap Icons - BsFillSignIntersectionYFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignIntersectionYFill
merge, merge-left, traffic, road, lane, highway, route, street, driving, vehicle, direction, navigation, warning, indicator, wayfinding, left, arrow, sign, control - Bootstrap Icons - BsFillSignMergeLeftFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignMergeLeftFill
merge, merge-right, lane, road, street, highway, traffic, vehicle, driving, navigation, right, route, arrow, indicator, warning, wayfinding, sign, control - Bootstrap Icons - BsFillSignMergeRightFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignMergeRightFill
no-left-turn, prohibited, restriction, traffic, road, street, route, driving, vehicle, navigation, left-turn, warning, indicator, control, sign, wayfinding, safety - Bootstrap Icons - BsFillSignNoLeftTurnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignNoLeftTurnFill
no-parking, parking-restriction, prohibited, vehicle, parking, traffic, street, road, property, warning, indicator, sign, urban, control, restriction-zone, navigation, map - Bootstrap Icons - BsFillSignNoParkingFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignNoParkingFill
no-right-turn, traffic, restriction, prohibited, right-turn, driving, vehicle, route, navigation, wayfinding, street, road, warning, indicator, sign, control - Bootstrap Icons - BsFillSignNoRightTurnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignNoRightTurnFill
railroad, train, railway, track, crossing, traffic, warning, transport, vehicle, route, navigation, sign, indicator, wayfinding, safety, road - Bootstrap Icons - BsFillSignRailroadFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignRailroadFill
stop, stop-sign, traffic, halt, warning, road, street, vehicle, driving, route, navigation, indicator, control, wayfinding, safety, alert - Bootstrap Icons - BsFillSignStopFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignStopFill
stop, lights, stoplights, traffic, signal, light-signal, intersection, road, street, halt, warning, red-light, transport, highway, navigation, map-marker, direction, driver, car, vehicle, safety, ui-icon, button, map-ui - Bootstrap Icons - BsFillSignStopLightsFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignStopLightsFill
turn, left, turn-left, direction, arrow-left, traffic, road, drive, driver, vehicle, navigation, route, map, path, sign, lanes, intersection, highway, transport, gps, map-ui, button - Bootstrap Icons - BsFillSignTurnLeftFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignTurnLeftFill
turn, right, turn-right, direction, arrow-right, traffic, road, intersection, driver, vehicle, navigation, gps, map, route, path, sign, transport, highway, map-ui - Bootstrap Icons - BsFillSignTurnRightFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignTurnRightFill
turn, slight-left, left, slight, direction, bend-left, curve-left, traffic, road, route, navigation, map, gps, driver, vehicle, transport, path, sign, intersection - Bootstrap Icons - BsFillSignTurnSlightLeftFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignTurnSlightLeftFill
turn, slight-right, right, slight, direction, bend-right, curve-right, traffic, road, route, navigation, gps, map, driver, vehicle, transport, path, sign - Bootstrap Icons - BsFillSignTurnSlightRightFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignTurnSlightRightFill
yield, give-way, triangle-sign, warning, road, traffic, intersection, driver, vehicle, caution, slow-down, navigation, sign, transport, map, gps, priority-road - Bootstrap Icons - BsFillSignYieldFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignYieldFill
signpost, post, direction, guide, route, path, navigation, map, pointer, marker, wayfinding, travel, tour, explore, destination, road, street, outdoor - Bootstrap Icons - BsFillSignpost2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignpost2Fill
signpost, sign, direction, navigation, map, pointer, marker, travel, guide, path, road, outdoor, wayfinding, destination, tourism, explore - Bootstrap Icons - BsFillSignpostFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignpostFill
signpost, split-sign, split, direction, navigation, route, path, map, pointer, destination, wayfinding, travel, choose-path, fork-road, outdoor - Bootstrap Icons - BsFillSignpostSplitFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSignpostSplitFill
skip, backward, skip-backward, media, media-control, player, rewind, previous, audio, video, track, button, btn, playback, navigation, toolbar, music, movie, media-player, control-button, seek-back - Bootstrap Icons - BsFillSkipBackwardBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipBackwardBtnFill
skip, backward, skip-backward, circle, round, media, rewind, previous, track, audio, video, player, playback, control, media-button, toolbar, music, navigation, seek-back - Bootstrap Icons - BsFillSkipBackwardCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipBackwardCircleFill
skip, backward, skip-backward, rewind, previous, track, audio, video, player, media, playback, control, media-button, toolbar, navigation, seek-back - Bootstrap Icons - BsFillSkipBackwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipBackwardFill
skip, end, skip-end, next, forward, media, track-end, audio, video, player, button, btn, media-control, toolbar, navigation, seek-forward, playback - Bootstrap Icons - BsFillSkipEndBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipEndBtnFill
skip, end, skip-end, next, forward, media, audio, video, player, track-end, playback, control, toolbar, navigation, seek-forward - Bootstrap Icons - BsFillSkipEndFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipEndFill
skip, forward, skip-forward, next, media, btn, button, audio, video, player, track, media-control, playback, navigation, seek-forward - Bootstrap Icons - BsFillSkipForwardBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipForwardBtnFill
skip, forward, skip-forward, circle, round, next, media, audio, video, player, control, playback, toolbar, navigation, seek-forward - Bootstrap Icons - BsFillSkipForwardCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipForwardCircleFill
skip, forward, skip-forward, next, media, audio, video, player, playback, control, navigation, seek-forward, toolbar - Bootstrap Icons - BsFillSkipForwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipForwardFill
skip, start, skip-start, rewind, beginning, btn, button, media, audio, video, track-start, player, control, playback, navigation - Bootstrap Icons - BsFillSkipStartBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSkipStartBtnFill
star, fill, filled, rating, favorite, bookmark, like, highlight, featured, award, review, rating-star, favorite-button, badge, icon-button, navigation, toolbar, badge-count, ui-element, svg, rating-widget, customer-review, top-pick, highlighted - Bootstrap Icons - BsFillStarFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStarFill
stop-btn, stop, button, media-control, playback, player, recording, pause-stop, transport, stop-action, icon-button, toolbar, control, filled, svg, audio, video, media-player, interaction, ui-element - Bootstrap Icons - BsFillStopBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStopBtnFill
stop-circle, stop, circle, media-control, playback, player, recording, transport, icon-button, toolbar, control, filled, svg, audio, video, media-player, status-indicator, interaction, ui-element - Bootstrap Icons - BsFillStopCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStopCircleFill
stop, filled, square, media-control, player, playback, transport, button, icon-button, toolbar, control, audio, video, recording, interaction, ui-element, svg - Bootstrap Icons - BsFillStopFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStopFill
stoplights, traffic-light, signals, traffic, transport, intersection, road, safety, status-indicator, green-yellow-red, map-icon, navigation, warning, control, filled, svg, urban, city, infrastructure, icon - Bootstrap Icons - BsFillStoplightsFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStoplightsFill
stopwatch, timer, time, chronometer, countdown, lap, clock, measurement, sports-timer, fitness, stopwatch-icon, filled, svg, timer-control, tracking, performance, ui-element, dashboard, tool - Bootstrap Icons - BsFillStopwatchFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStopwatchFill
taxi, cab, car, transport, vehicle, front-view, ride, travel, maps, navigation, pickup, drop, commute, city-transport, uber, ola - Bootstrap Icons - BsFillTaxiFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTaxiFrontFill
train, freight-train, cargo, rail, locomotive, transport, logistics, shipping, delivery, freight, railway, front-view, vehicle, industrial, supply-chain - Bootstrap Icons - BsFillTrainFreightFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTrainFreightFrontFill
train, rail, railway, metro, subway, commute, travel, transport, front-view, vehicle, public-transport, station, transit, ui - Bootstrap Icons - BsFillTrainFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTrainFrontFill
truck, delivery, freight, shipping, transport, cargo, vehicle, front-view, logistics, supply-chain, courier, ecommerce, road - Bootstrap Icons - BsFillTruckFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTruckFrontFill
tv, television, screen, monitor, display, media, video, entertainment, electronics, device, smart-tv, home, ui - Bootstrap Icons - BsFillTvFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTvFill
reverse, layout, sidebar, inset, reverse-layout, sidebar-inset, ui, interface, web-layout, panel, navigation, columns, page-structure, template, responsive, design, dashboard, left-sidebar, right-sidebar - Bootstrap Icons - BsReverseLayoutSidebarInsetReverse - SVG | WEBP | PNG | JPG - Icon free download
BsReverseLayoutSidebarInsetReverse
reverse, layout, sidebar, reverse-layout, panel, navigation, columns, structure, template, ui, interface, responsive, design, web-layout, builder, toggle-sidebar - Bootstrap Icons - BsReverseLayoutSidebarReverse - SVG | WEBP | PNG | JPG - Icon free download
BsReverseLayoutSidebarReverse
activity, heartbeat, pulse, monitor, analytics, chart, signal, graph, tracking, performance, health, status, monitoring, metric - Bootstrap Icons - BsActivity - SVG | WEBP | PNG | JPG - Icon free download
BsActivity
airplane, plane, jet, engines, airplane-engines, filled, flight, travel, aviation, airport, journey, airlines, takeoff, logistics - Bootstrap Icons - BsAirplaneEnginesFill - SVG | WEBP | PNG | JPG - Icon free download
BsAirplaneEnginesFill
airplane, plane, jet, engines, airplane-engines, outline, flight, travel, aviation, airport, journey, airlines - Bootstrap Icons - BsAirplaneEngines - SVG | WEBP | PNG | JPG - Icon free download
BsAirplaneEngines
airplane, plane, jet, flight, travel, filled, aviation, airport, airline, journey, takeoff, trip - Bootstrap Icons - BsAirplaneFill - SVG | WEBP | PNG | JPG - Icon free download
BsAirplaneFill
airplane, plane, jet, flight, travel, outline, aviation, airport, airline, journey, trip - Bootstrap Icons - BsAirplane - SVG | WEBP | PNG | JPG - Icon free download
BsAirplane
arrow, left, 90deg, rotate-left, turn-left, direction, navigation, ui, interface, pointer, cursor, button, sidebar, back, previous, undo, layout, ios, android, web, header, footer, action, navigate-left - Bootstrap Icons - BsArrow90DegLeft - SVG | WEBP | PNG | JPG - Icon free download
BsArrow90DegLeft
arrow, right, 90deg, rotate-right, turn-right, direction, navigation, ui, pointer, cursor, button, next, forward, layout, toolbar, sidebar, navigate-right, ios, android, web - Bootstrap Icons - BsArrow90DegRight - SVG | WEBP | PNG | JPG - Icon free download
BsArrow90DegRight
arrow, up, 90deg, rotate-up, turn-up, direction, navigation, scroll-up, jump-up, ui, controls, toolbar, header, navigate-up, pointer, cursor, android, ios - Bootstrap Icons - BsArrow90DegUp - SVG | WEBP | PNG | JPG - Icon free download
BsArrow90DegUp
arrow, down, bar, arrow-bar-down, download, collapse, minimize, navigation, ui, controls, pointer, cursor, toolbar, header, footer, scroll-down, navigate-down - Bootstrap Icons - BsArrowBarDown - SVG | WEBP | PNG | JPG - Icon free download
BsArrowBarDown
arrow, left, bar, arrow-bar-left, sidebar, collapse-left, navigation, ui, pointer, cursor, previous, back, toolbar, panel, navigate-left - Bootstrap Icons - BsArrowBarLeft - SVG | WEBP | PNG | JPG - Icon free download
BsArrowBarLeft
arrow, right, bar, arrow-bar-right, sidebar-open, expand-right, navigation, ui, pointer, cursor, next, forward, toolbar, panel, navigate-right - Bootstrap Icons - BsArrowBarRight - SVG | WEBP | PNG | JPG - Icon free download
BsArrowBarRight
arrow, up, bar, arrow-bar-up, expand-up, scroll-up, navigation, ui, cursor, pointer, toolbar, panel, navigate-up - Bootstrap Icons - BsArrowBarUp - SVG | WEBP | PNG | JPG - Icon free download
BsArrowBarUp
arrow, clockwise, rotate, refresh, reload, sync, update, retry, navigation, ui, action, system, toolbar, loading, spinner, repeat - Bootstrap Icons - BsArrowClockwise - SVG | WEBP | PNG | JPG - Icon free download
BsArrowClockwise
arrow, counterclockwise, rotate-left, undo, reverse, reload, refresh, sync, navigation, ui, action, retry, spinner, rotate-back - Bootstrap Icons - BsArrowCounterclockwise - SVG | WEBP | PNG | JPG - Icon free download
BsArrowCounterclockwise
arrow, down-left, square, outline, down-left-square, navigation, direction, ui, pointer, cursor, corner, transition - Bootstrap Icons - BsArrowDownLeftSquare - SVG | WEBP | PNG | JPG - Icon free download
BsArrowDownLeftSquare
arrow, right, arrow-right, circle, right-circle, navigate, next, forward, chevron, pointer, direction, ui, button, icon, navigation, menu, sidebar, header, footer, ios, android, web, flow, step, move, proceed - Bootstrap Icons - BsArrowRightCircle - SVG | WEBP | PNG | JPG - Icon free download
BsArrowRightCircle
arrows, vertical, up-down, direction, scroll, resize, drag, movement, ui-control, navigation, layout-adjust, pointer - Bootstrap Icons - BsArrowsVertical - SVG | WEBP | PNG | JPG - Icon free download
BsArrowsVertical
bar, chart, steps, bar-chart-steps, analytics, progress, milestones, statistics, dashboard, outline, visualization, metrics, ui, web, mobile, bootstrap - Bootstrap Icons - BsBarChartSteps - SVG | WEBP | PNG | JPG - Icon free download
BsBarChartSteps
bezier, curve, vector, path, pen-tool, anchor, graphics, design, illustration, editing, ui, toolbar, shape, svg - Bootstrap Icons - BsBezier - SVG | WEBP | PNG | JPG - Icon free download
BsBezier
bezier, curve, vector, path, anchor, pen, graphics, editing, design, shape, ui, toolbar, illustration - Bootstrap Icons - BsBezier2 - SVG | WEBP | PNG | JPG - Icon free download
BsBezier2
bicycle, bike, cycle, transport, travel, ride, fitness, outdoor, commute, eco, mobility, vehicle, cycling, sports, navigation, path, road, touring, icon, ui - Bootstrap Icons - BsBicycle - SVG | WEBP | PNG | JPG - Icon free download
BsBicycle
bing, brand, search, engine, microsoft, web, internet, seo, query, lookup, browser, logo, branding, ui, navigation - Bootstrap Icons - BsBing - SVG | WEBP | PNG | JPG - Icon free download
BsBing
binoculars, search, zoom, explore, observe, lookout, view, scout, filled, outdoor, travel, tracking, inspect, focus, ui, exploration - Bootstrap Icons - BsBinocularsFill - SVG | WEBP | PNG | JPG - Icon free download
BsBinocularsFill
binoculars, search, zoom, explore, observe, lookout, view, scout, outline, tracking, inspect, focus, ui, exploration - Bootstrap Icons - BsBinoculars - SVG | WEBP | PNG | JPG - Icon free download
BsBinoculars
box, arrow, down, left, box-arrow-down-left, export, download, out, move, direction, navigation, ui, action, workflow, panel, file, button, hover - Bootstrap Icons - BsBoxArrowDownLeft - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowDownLeft
box, arrow, down, right, box-arrow-down-right, export, download, move, direction, ui, navigation, workflow, file, button, hover, panel - Bootstrap Icons - BsBoxArrowDownRight - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowDownRight
box, arrow, in, up, left, box-arrow-in-up-left, import, incoming, upload, move, direction, ui, navigation, caret, pointer, corner, entry, sidebar, toolbar-action, menu-action, button - Bootstrap Icons - BsBoxArrowInUpLeft - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInUpLeft
box, arrow, in, up, right, box-arrow-in-up-right, import, incoming, upload, direction, ui, navigation, pointer, caret, corner, entry, button, menu-action - Bootstrap Icons - BsBoxArrowInUpRight - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInUpRight
box, arrow, in, up, box-arrow-in-up, upload, import, incoming, upward, action, pointer, ui-control, navigation, toolbar-action - Bootstrap Icons - BsBoxArrowInUp - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInUp
box, arrow, up, right, box-arrow-up-right, export, outgoing, move-out, upward, corner, ui, pointer, navigation, toolbar - Bootstrap Icons - BsBoxArrowUpRight - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowUpRight
box, fill, box-fill, container, package, parcel, item, square, solid-box, storage, inventory, product, shipment - Bootstrap Icons - BsBoxFill - SVG | WEBP | PNG | JPG - Icon free download
BsBoxFill
box, seam, fill, box-seam-fill, package, parcel, sealed-box, container, logistics, warehouse, inventory, shipping, delivery - Bootstrap Icons - BsBoxSeamFill - SVG | WEBP | PNG | JPG - Icon free download
BsBoxSeamFill
boxes, multiple, stack, packages, parcels, containers, inventory, warehouse, logistics, shipping, delivery, product, bulk, crate, stacked-boxes - Bootstrap Icons - BsBoxes - SVG | WEBP | PNG | JPG - Icon free download
BsBoxes
browser, firefox, mozilla, web, internet, tabs, navigation, search, engine, homepage, ui, toolbar, app, software, window, web-app, bookmark, address-bar, security, open-source, brand - Bootstrap Icons - BsBrowserFirefox - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserFirefox
browser, safari, apple, apple-browser, web, internet, search, engine, navigation, tabs, bookmark, ui, toolbar, macos, ios, window, web-app, address-bar, brand - Bootstrap Icons - BsBrowserSafari - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserSafari
building, office, tower, skyscraper, city, structure, real-estate, property, headquarters, enterprise, company, location, map, urban, infrastructure, block, complex, estate, landmark, navigation, ui, header, sidebar, button - Bootstrap Icons - BsBuildingFill - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFill
building, up, growth, increase, upgrade, expansion, rise, progress, city, property, development, elevation, improvement, boost, enhancement, advancement, real-estate-growth, analytics - Bootstrap Icons - BsBuildingUp - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingUp
bus, front, vehicle, transport, public-transport, commute, travel, road, shuttle, transit, transportation, city-bus, route, map, stop, station, infrastructure - Bootstrap Icons - BsBusFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsBusFrontFill
bus, front, vehicle, transport, commute, transit, public-transport, road, travel, city-bus, route, station, map, stop, navigation - Bootstrap Icons - BsBusFront - SVG | WEBP | PNG | JPG - Icon free download
BsBusFront
calendar, date, calendar-date, day, schedule, event, time, deadline, filled, ui, planner, appointment, booking, reminder, month, daily, view, agenda, tracking - Bootstrap Icons - BsCalendarDateFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarDateFill
calendar, date, calendar-date, day, schedule, event, time, deadline, outline, ui, planner, appointment, booking, reminder, month, daily, view, agenda, tracking - Bootstrap Icons - BsCalendarDate - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarDate
calendar, day, calendar-day, schedule, event, time, filled, appointment, planner, daily, agenda, reminder, booking, ui, tracking, month, date - Bootstrap Icons - BsCalendarDayFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarDayFill
calendar, day, calendar-day, schedule, event, time, outline, appointment, planner, daily, agenda, reminder, booking, ui, tracking, month, date - Bootstrap Icons - BsCalendarDay - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarDay
calendar, event, calendar-event, schedule, appointment, meeting, planner, date, reminder, timeline, agenda, work, task, booking, ui, header, toolbar, icon, outline, month-view, day-view - Bootstrap Icons - BsCalendarEvent - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarEvent
calendar, range, calendar-range, date-range, filled, period, timeline, schedule, planner, booking, range-picker - Bootstrap Icons - BsCalendarRangeFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarRangeFill
calendar, range, calendar-range, period, date-range, line, schedule, planner, ui, timeline - Bootstrap Icons - BsCalendarRange - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarRange
calendar, week, calendar-week, filled, weekly-view, schedule, planner, agenda, ui, date, timeline - Bootstrap Icons - BsCalendarWeekFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarWeekFill
calendar, week, calendar-week, line, weekly, schedule, planner, agenda, date, timeline - Bootstrap Icons - BsCalendarWeek - SVG | WEBP | PNG | JPG - Icon free download
BsCalendarWeek
calendar, date, schedule, planner, event, month, day, ui, header, navigation, toolbar, appointment, meetings, ios, android - Bootstrap Icons - BsCalendar - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar
calendar, date, day, schedule, planner, timeline, event, ui, outline-calendar, appointment - Bootstrap Icons - BsCalendar2Date - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar2Date
calendar, event, outline-calendar, schedule, reminder, planner, appointment, task, timeline - Bootstrap Icons - BsCalendar2Event - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar2Event
calendar, calendar3, event, calendar-event, schedule, date, day, appointment, meeting, planner, timeline, agenda, reminder, booking, ui, ux, toolbar, menu, button, header, footer, nav, ios, android, webapp - Bootstrap Icons - BsCalendar3Event - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3Event
calendar, calendar3, range, date-range, range-fill, filled, duration, period, interval, schedule, timeline, planner, booking, availability, ui, ux, datepicker, range-picker, webapp - Bootstrap Icons - BsCalendar3RangeFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3RangeFill
calendar, calendar3, range, date-range, outline, interval, period, duration, availability, planner, timeline, booking, datepicker, range-picker, ui, ux, toolbar - Bootstrap Icons - BsCalendar3Range - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3Range
calendar, calendar3, week, week-view, filled, weekly, planner, agenda, schedule, timeline, ui, ux, dashboard, toolbar, header, android, ios - Bootstrap Icons - BsCalendar3WeekFill - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3WeekFill
calendar, calendar3, week, weekly, outline, planner, agenda, schedule, date, timeline, ui, ux, webapp, toolbar, meeting, events - Bootstrap Icons - BsCalendar3Week - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar3Week
calendar, calendar4, event, calendar-event, schedule, meeting, appointment, planner, timeline, agenda, booking, ui, ux, toolbar, date - Bootstrap Icons - BsCalendar4Event - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar4Event
calendar, calendar4, range, date-range, interval, duration, period, datepicker, range-picker, planner, schedule, booking, ui, ux, timeline - Bootstrap Icons - BsCalendar4Range - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar4Range
calendar, calendar4, week, weekly, weekly-view, planner, agenda, schedule, timeline, ui, ux, toolbar, date, meeting - Bootstrap Icons - BsCalendar4Week - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar4Week
calendar, calendar4, date, day, month, year, schedule, event, planner, agenda, booking, appointments, timeline, reminder, ui, navbar, toolbar, button, sidebar, productivity, office - Bootstrap Icons - BsCalendar4 - SVG | WEBP | PNG | JPG - Icon free download
BsCalendar4
car, vehicle, front-view, automobile, transport, drive, travel, taxi, ride, navigation, road, filled - Bootstrap Icons - BsCarFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsCarFrontFill
car, vehicle, front-view, automobile, transport, navigation, drive, travel, outline, road - Bootstrap Icons - BsCarFront - SVG | WEBP | PNG | JPG - Icon free download
BsCarFront
caret, down, arrow, dropdown, menu, expand, collapse, navigation, filled, ui-control - Bootstrap Icons - BsCaretDownFill - SVG | WEBP | PNG | JPG - Icon free download
BsCaretDownFill
caret, down, arrow, dropdown, expand, collapse, selector, navigation, outline - Bootstrap Icons - BsCaretDown - SVG | WEBP | PNG | JPG - Icon free download
BsCaretDown
chevron, bar, down, dropdown, expand-down, scroll-down, arrow-down, navigation, ui, list, menu, collapse, toggle - Bootstrap Icons - BsChevronBarDown - SVG | WEBP | PNG | JPG - Icon free download
BsChevronBarDown
chevron, double, down, double-down, arrow, navigate, scroll, collapse, dropdown, direction, ui, button, control, navigation, expand, footer, sidebar, android, ios, web - Bootstrap Icons - BsChevronDoubleDown - SVG | WEBP | PNG | JPG - Icon free download
BsChevronDoubleDown
clipboard, pulse, clipboard-pulse, heartbeat, monitor, health, medical, vitals, record, chart, report, analytics, hospital, wellness, tracking, ui, dashboard - Bootstrap Icons - BsClipboardPulse - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardPulse
clipboard, data, clipboard-data, analytics, chart, stats, report, filled, document, sheet, form, tracking, metrics, business, monitor - Bootstrap Icons - BsClipboard2DataFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2DataFill
clipboard, data, clipboard-data, analytics, stats, report, outline, document, sheet, metrics, dashboard, tracking, business - Bootstrap Icons - BsClipboard2Data - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2Data
clipboard, clipboard2, pulse, heartbeat, health, medical, vitals, monitoring, report, record, patient, checkup, filled, hospital, clinic, form, document, health-data, tracking - Bootstrap Icons - BsClipboard2PulseFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2PulseFill
clipboard, clipboard2, pulse, heartbeat, vitals, monitor, health, medical, outline, patient, record, report, data, tracking, hospital, clinic, ui, form - Bootstrap Icons - BsClipboard2Pulse - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2Pulse
clock, time, timer, filled, schedule, duration, hour, minute, alarm, tracking, clock-fill, ui, dashboard, deadline, history, reminder, event - Bootstrap Icons - BsClockFill - SVG | WEBP | PNG | JPG - Icon free download
BsClockFill
clock, history, time, recent, past, timeline, log, records, tracking, event, restore, previous, clock-history, ui, dashboard - Bootstrap Icons - BsClockHistory - SVG | WEBP | PNG | JPG - Icon free download
BsClockHistory
clock, time, timer, schedule, hour, minute, outline, alarm, deadline, reminder, tracking, ui, dashboard, event, timepiece - Bootstrap Icons - BsClock - SVG | WEBP | PNG | JPG - Icon free download
BsClock
compass-fill, compass, navigation, direction, map, travel, gps, location, orientation, explore, wayfinding, ui, tool - Bootstrap Icons - BsCompassFill - SVG | WEBP | PNG | JPG - Icon free download
BsCompassFill
compass, navigation, direction, map, gps, location, wayfinding, explore, orientation, ui, travel - Bootstrap Icons - BsCompass - SVG | WEBP | PNG | JPG - Icon free download
BsCompass
cursor, mouse-pointer, pointer, click, selection, hover, ui, navigation, interaction, input, clickable, button-target, filled, pointer-icon - Bootstrap Icons - BsCursorFill - SVG | WEBP | PNG | JPG - Icon free download
BsCursorFill
cursor, pointer, mouse-pointer, click, hover, navigation, ui, interaction, select, outline, control - Bootstrap Icons - BsCursor - SVG | WEBP | PNG | JPG - Icon free download
BsCursor
display, monitor, screen, desktop, pc, computer, filled, device, hardware, workstation, ui, presentation, preview, layout, dashboard, web, ios, android - Bootstrap Icons - BsDisplayFill - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayFill
display, monitor, screen, desktop, outline, pc, computer, device, hardware, workspace, dashboard, preview, ui, web, minimal, android, ios - Bootstrap Icons - BsDisplay - SVG | WEBP | PNG | JPG - Icon free download
BsDisplay
displayport, port, connector, filled, cable, video-output, monitor, screen, hardware, device, pc, laptop, input-output, tech, ui, web - Bootstrap Icons - BsDisplayportFill - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayportFill
displayport, port, connector, outline, video-output, monitor, hardware, pc, laptop, screen, device, tech, wire, cable, ui, web, ios, android - Bootstrap Icons - BsDisplayport - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayport
door, open, outline, entry, exit, home, office, building, access, welcome, state, navigation, symbol, ui, web, ios, android - Bootstrap Icons - BsDoorOpen - SVG | WEBP | PNG | JPG - Icon free download
BsDoorOpen
dpad, controller, gamepad, directional-pad, filled, gaming, console, navigation, arrow, up, down, left, right, input, control, ui, android, ios, web - Bootstrap Icons - BsDpadFill - SVG | WEBP | PNG | JPG - Icon free download
BsDpadFill
dpad, directional-pad, game-control, controller, navigation, arrow-pad, game-ui, gaming-input, multimedia-control, console, joystick, move, navigate, button, ux-control, focus, cursor, remote-control - Bootstrap Icons - BsDpad - SVG | WEBP | PNG | JPG - Icon free download
BsDpad
duffle, bag, duffle-bag, travel, luggage, gym-bag, backpack, carry, packed, trip, journey, tour, filled, storage, vacation - Bootstrap Icons - BsDuffleFill - SVG | WEBP | PNG | JPG - Icon free download
BsDuffleFill
envelope, mail, email, at, address, message, contact, outline, send, communication, newsletter, reply, ui, button, icon, navigation - Bootstrap Icons - BsEnvelopeAt - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeAt
envelope, mail, email, message, filled, compose, send, inbox, outbox, reply, contact, ui, icon, navigation - Bootstrap Icons - BsEnvelopeFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeFill
envelope, email, mail, message, inbox, send, receive, communication, outline, ui, button, toolbar, navigation, contact, notification - Bootstrap Icons - BsEnvelope - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelope
escape, esc, key, keyboard, exit, close, cancel, navigation, shortcut, outline, system, ui, modal-close - Bootstrap Icons - BsEscape - SVG | WEBP | PNG | JPG - Icon free download
BsEscape
ev, front, car, electric-vehicle, auto, vehicle, front-view, eco, transport, filled, charging, mobility, green-energy - Bootstrap Icons - BsEvFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsEvFrontFill
ev, front, car, electric-vehicle, vehicle, eco, outline, mobility, transport, green-energy, auto - Bootstrap Icons - BsEvFront - SVG | WEBP | PNG | JPG - Icon free download
BsEvFront
ev, station, charging, electric, power, eco, vehicle, filled, fuel, energy, charger, mobility, transport, map-pin - Bootstrap Icons - BsEvStationFill - SVG | WEBP | PNG | JPG - Icon free download
BsEvStationFill
ev, station, charging, electric, power, eco, vehicle, outline, fuel, charger, mobility, transport, map-location - Bootstrap Icons - BsEvStation - SVG | WEBP | PNG | JPG - Icon free download
BsEvStation
fast, forward, fast-forward, circle, media, skip, next, jump, playback, player, control, ui, button, video, audio, music, timeline, speed, motion, quick, shortcut, media-player, round, filled - Bootstrap Icons - BsFastForwardCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFastForwardCircleFill
fast, forward, fast-forward, circle, outline, media, skip, next, jump, player, control, video, audio, music, ui, icon, timeline, motion, speed, quick, media-player - Bootstrap Icons - BsFastForwardCircle - SVG | WEBP | PNG | JPG - Icon free download
BsFastForwardCircle
fast, forward, fast-forward, double-arrow, skip, next, filled, media, player, control, video, audio, music, timeline, jump, motion, quick, ui, button - Bootstrap Icons - BsFastForwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFastForwardFill
fast, forward, fast-forward, skip, next, outline, media, control, player, video, audio, music, timeline, jump, speed, motion, ui - Bootstrap Icons - BsFastForward - SVG | WEBP | PNG | JPG - Icon free download
BsFastForward
file, earmark, music, audio, sound, mp3, song, playlist, media, track, editor, upload, download, ui - Bootstrap Icons - BsFileEarmarkMusicFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkMusicFill
file, earmark, music, audio, sound, track, song, playlist, media, editor, upload, download, ui - Bootstrap Icons - BsFileEarmarkMusic - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkMusic
file, earmark, person, user, profile, id, identity, contact, document, record, employee, staff, account, profile-page, profile-section, avatar, user-details, user-data, form, admin, office-file, people-management, directory, team, navigation, sidebar - Bootstrap Icons - BsFileEarmarkPerson - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPerson
file, earmark, play, video, media, clip, stream, movie, multimedia, playback, player, media-file, video-file, outline-file, button, navigation - Bootstrap Icons - BsFileEarmarkPlay - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPlay
file, music, file-music, audio, song, track, mp3, sound, media, media-file, audio-file, music-note, playlist, library, entertainment, attachment - Bootstrap Icons - BsFileMusicFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileMusicFill
file, music, file-music, audio, track, song, mp3, sound, media, audio-file, music-file, library, playlist, entertainment - Bootstrap Icons - BsFileMusic - SVG | WEBP | PNG | JPG - Icon free download
BsFileMusic
file, m4p, audio, music, protected, itunes, song, track, media, format, player, sound, library, assets, audio-file - Bootstrap Icons - BsFiletypeM4P - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeM4P
file, mov, video, quicktime, movie, clip, media, format, editor, timeline, footage, assets, upload, multimedia, playback - Bootstrap Icons - BsFiletypeMov - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeMov
file, mp3, audio, music, song, track, sound, media, playlist, assets, library, player, audio-file, compression - Bootstrap Icons - BsFiletypeMp3 - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeMp3
file, wav, filetype-wav, audio, sound, music, editor, recording, media, sample, track, import, download, attachment, waveform, player, mix, production - Bootstrap Icons - BsFiletypeWav - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeWav
file, xls, excel, spreadsheet, sheet, table, data, report, analysis, workbook, filetype, office, ms-excel, download, upload, grid, csv, import, export, button, navigation - Bootstrap Icons - BsFiletypeXls - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeXls
film, movie, video, media, cinema, reel, clip, recording, playback, editor, entertainment, gallery, library, poster, timeline, ui, button, menu - Bootstrap Icons - BsFilm - SVG | WEBP | PNG | JPG - Icon free download
BsFilm
forward, next, arrow, move, media-forward, skip, navigation, playback - Bootstrap Icons - BsForwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsForwardFill
forward, arrow, next, skip, advance, media, navigation, ui - Bootstrap Icons - BsForward - SVG | WEBP | PNG | JPG - Icon free download
BsForward
fuel, pump, fuel-pump, gas, petrol, diesel, station, refuel, energy, car, vehicle, automotive, travel, journey, maps, navigation, service-station, icon, ui, toolbar, menu, button - Bootstrap Icons - BsFuelPumpFill - SVG | WEBP | PNG | JPG - Icon free download
BsFuelPumpFill
fuel, pump, gas, petrol, diesel, station, refuel, energy, car, vehicle, automotive, navigation, map, service-station, thin-line, outline-icon, ui, toolbar, menu - Bootstrap Icons - BsFuelPump - SVG | WEBP | PNG | JPG - Icon free download
BsFuelPump
geo, alt, location, pin, marker, map, gps, navigation, geolocation, destination, travel, route, check-in, position, filled - Bootstrap Icons - BsGeoAltFill - SVG | WEBP | PNG | JPG - Icon free download
BsGeoAltFill
geo, alt, location, pin, marker, map, gps, navigation, geolocation, route, destination, thin-line, outline - Bootstrap Icons - BsGeoAlt - SVG | WEBP | PNG | JPG - Icon free download
BsGeoAlt
geo, location, pin, marker, map, gps, navigation, destination, travel, geolocation, filled, ui - Bootstrap Icons - BsGeoFill - SVG | WEBP | PNG | JPG - Icon free download
BsGeoFill
geo, location, map, pin, marker, gps, navigation, geolocation, route, outline, thin-line - Bootstrap Icons - BsGeo - SVG | WEBP | PNG | JPG - Icon free download
BsGeo
grid, 3x2, 3x2-grid, gap, filled, layout, interface, ui, matrix, tiles, blocks, dashboard, cards, sections, modules, widgets, apps, home-screen, menu-grid, navigation, button, select, arrange, structure, panel, responsive, web, mobile - Bootstrap Icons - BsGrid3X2GapFill - SVG | WEBP | PNG | JPG - Icon free download
BsGrid3X2GapFill
hand, index, pointer, tap, click, interaction, gesture, filled, cursor, touch, select, press, ui, mobile, action, navigation - Bootstrap Icons - BsHandIndexFill - SVG | WEBP | PNG | JPG - Icon free download
BsHandIndexFill
hand, index, thumb, gesture, click, tap, filled, pointer, interaction, ui, touch, select, navigation, action, cursor - Bootstrap Icons - BsHandIndexThumbFill - SVG | WEBP | PNG | JPG - Icon free download
BsHandIndexThumbFill
hand, index, pointer, outline, tap, click, gesture, cursor, touch, ui, interaction, select, navigation - Bootstrap Icons - BsHandIndex - SVG | WEBP | PNG | JPG - Icon free download
BsHandIndex
hand, thumbs, down, thumbs-down, dislike, negative, reject, vote-down, feedback, response, rating, gesture, ui-icon, outline, action, navigation, sidebar, button, toggle - Bootstrap Icons - BsHandThumbsDown - SVG | WEBP | PNG | JPG - Icon free download
BsHandThumbsDown
hdmi, cable, port, display, connector, video, audio, filled, interface, tv, monitor, projector, hardware - Bootstrap Icons - BsHdmiFill - SVG | WEBP | PNG | JPG - Icon free download
BsHdmiFill
hdmi, cable, port, connector, outline, display, video, audio, tv, monitor, hardware, settings - Bootstrap Icons - BsHdmi - SVG | WEBP | PNG | JPG - Icon free download
BsHdmi
heart, pulse, heartbeat, vitals, ecg, health, medical, monitor, fitness, wellness, filled, cardio, health-monitoring, tracker, diagnostics - Bootstrap Icons - BsHeartPulseFill - SVG | WEBP | PNG | JPG - Icon free download
BsHeartPulseFill
hourglass, bottom, time, timer, countdown, loading, wait, progress, pending, indicator, ui-status - Bootstrap Icons - BsHourglassBottom - SVG | WEBP | PNG | JPG - Icon free download
BsHourglassBottom
hourglass, split, time, loading, timer, progress, indicator, pending, wait, countdown, ui - Bootstrap Icons - BsHourglassSplit - SVG | WEBP | PNG | JPG - Icon free download
BsHourglassSplit
hourglass, top, hourglass-top, timer, countdown, waiting, loading, progress, duration, time-limit, time-tracking, clock, indicator, ui, status, task, workflow, delay - Bootstrap Icons - BsHourglassTop - SVG | WEBP | PNG | JPG - Icon free download
BsHourglassTop
hourglass, sandclock, timer, wait, loading, duration, countdown, progress, delay, time-management, ui, indicator, workflow, schedule, clock - Bootstrap Icons - BsHourglass - SVG | WEBP | PNG | JPG - Icon free download
BsHourglass
house, home, building, property, residential, real-estate, housing, home-page, navigation, map, ui-icon - Bootstrap Icons - BsHouseFill - SVG | WEBP | PNG | JPG - Icon free download
BsHouseFill
inboxes, inbox, mail, email, messages, folders, storage, archive, communication, workspace, dashboard, ui, sidebar, navigation, container, multiple-inbox, incoming, sorting, organization - Bootstrap Icons - BsInboxes - SVG | WEBP | PNG | JPG - Icon free download
BsInboxes
intersect, intersection, overlap, shape, geometry, design, graphics, vector, path, ui, layout, combine, merge - Bootstrap Icons - BsIntersect - SVG | WEBP | PNG | JPG - Icon free download
BsIntersect
kanban, board, task, workflow, project, filled, card, todo, manage, track - Bootstrap Icons - BsKanbanFill - SVG | WEBP | PNG | JPG - Icon free download
BsKanbanFill
kanban, board, task, workflow, project, outline, todo, management, tracking - Bootstrap Icons - BsKanban - SVG | WEBP | PNG | JPG - Icon free download
BsKanban
layout, sidebar, inset, reverse, layout-sidebar-inset-reverse, two-column, page-template, dashboard, admin, responsive, template, panel, navigation, content, grid - Bootstrap Icons - BsLayoutSidebarInsetReverse - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebarInsetReverse
layout, sidebar, inset, layout-sidebar-inset, two-column, page-template, dashboard, admin, responsive, template, panel, navigation, content, grid - Bootstrap Icons - BsLayoutSidebarInset - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebarInset
layout, sidebar, reverse, layout-sidebar-reverse, left-sidebar, right-sidebar, page-template, dashboard, admin, responsive, navigation, content, panel - Bootstrap Icons - BsLayoutSidebarReverse - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebarReverse
layout, sidebar, layout-sidebar, left-sidebar, right-sidebar, page-template, dashboard, admin, navigation, content, panel, responsive, template - Bootstrap Icons - BsLayoutSidebar - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutSidebar
life, preserver, lifebuoy, lifesaver, float, safety, rescue, emergency, help, support, warning, marine, boating, navigation, alert, symbol, outline, ui, toolbar, button - Bootstrap Icons - BsLifePreserver - SVG | WEBP | PNG | JPG - Icon free download
BsLifePreserver
link, chain, hyperlink, connect, url, reference, navigation, relation, attachment, outline, ui - Bootstrap Icons - BsLink - SVG | WEBP | PNG | JPG - Icon free download
BsLink
list, ul, unordered-list, bullet-list, text, content, items, menu, navigation, structure, layout, document, notes, tasks, todo, outline, web, app, ui, sidebar, panel, markdown, rich-text - Bootstrap Icons - BsListUl - SVG | WEBP | PNG | JPG - Icon free download
BsListUl
list, menu, items, nav, navigation, text, content, outline, tasks, todo, notes, structure, layout, sidebar, ui, web, app, panel, table-of-contents - Bootstrap Icons - BsList - SVG | WEBP | PNG | JPG - Icon free download
BsList
luggage, bag, suitcase, travel, tour, trip, vacation, baggage, airport, hotel, tourism, carry, package, logistics, transport, filled - Bootstrap Icons - BsLuggageFill - SVG | WEBP | PNG | JPG - Icon free download
BsLuggageFill
luggage, suitcase, bag, travel, tourism, airport, vacation, trip, baggage, carry, package, transport, logistics, outline, hotel - Bootstrap Icons - BsLuggage - SVG | WEBP | PNG | JPG - Icon free download
BsLuggage
map, filled, location, navigation, gps, direction, route, travel, tour, geography, area, region, guide, explore, ui, map-view - Bootstrap Icons - BsMapFill - SVG | WEBP | PNG | JPG - Icon free download
BsMapFill
map, outline, navigation, location, gps, route, geography, travel, direction, explore, guide, area, region, map-view - Bootstrap Icons - BsMap - SVG | WEBP | PNG | JPG - Icon free download
BsMap
menu, app-menu, grid, navigation, filled, launcher, apps, dashboard, ui, toolbar, tiles, home-screen, buttons, sidebar, mobile, navigation-drawer - Bootstrap Icons - BsMenuAppFill - SVG | WEBP | PNG | JPG - Icon free download
BsMenuAppFill
menu, app, grid, launcher, navigation, outline, ui, toolbar, drawer, tiles, dashboard, icon, apps, home-screen - Bootstrap Icons - BsMenuApp - SVG | WEBP | PNG | JPG - Icon free download
BsMenuApp
menu-button, filled, menu, ui, navigation, button, toolbar, action, controls, toggle, header, footer, sidebar, hamburger - Bootstrap Icons - BsMenuButtonFill - SVG | WEBP | PNG | JPG - Icon free download
BsMenuButtonFill
menu-button, wide-button, filled, menu, navigation, toolbar, ui, button, wide-layout, header, footer, controls, toggle - Bootstrap Icons - BsMenuButtonWideFill - SVG | WEBP | PNG | JPG - Icon free download
BsMenuButtonWideFill
menu-button, wide, outline, menu, navigation, toolbar, ui, button, header, footer, toggle, controls - Bootstrap Icons - BsMenuButtonWide - SVG | WEBP | PNG | JPG - Icon free download
BsMenuButtonWide
menu-button, menu, navigation, outline, toolbar, ui, button, toggle, header, footer, controls, hamburger - Bootstrap Icons - BsMenuButton - SVG | WEBP | PNG | JPG - Icon free download
BsMenuButton
menu-down, arrow-down, dropdown, expand, navigation, ui, control, chevron, outline, toggle, collapsible, menu - Bootstrap Icons - BsMenuDown - SVG | WEBP | PNG | JPG - Icon free download
BsMenuDown
menu-up, arrow-up, collapse, dropdown, navigation, ui, control, chevron, outline, menu, toggle - Bootstrap Icons - BsMenuUp - SVG | WEBP | PNG | JPG - Icon free download
BsMenuUp
minecart, loaded, cart, mining, cargo, load, transport, industry, rail, haul, resources, materials, delivery, logistics, container, goods, wagon - Bootstrap Icons - BsMinecartLoaded - SVG | WEBP | PNG | JPG - Icon free download
BsMinecartLoaded
minecart, cart, mining, coal, rail, industry, transport, haul, container, wagon, empty-cart, resources, logistics, materials - Bootstrap Icons - BsMinecart - SVG | WEBP | PNG | JPG - Icon free download
BsMinecart
mouse, filled, pointer, input, device, computer, hardware, click, cursor, navigation, desktop, peripheral, interaction, ui - Bootstrap Icons - BsMouseFill - SVG | WEBP | PNG | JPG - Icon free download
BsMouseFill
mouse, outline, pointer, cursor, input, device, computer, hardware, click, peripheral, desktop, navigation - Bootstrap Icons - BsMouse - SVG | WEBP | PNG | JPG - Icon free download
BsMouse
mouse2, filled, mouse, input, device, hardware, computer, pointer, cursor, peripheral, gaming, click, navigation - Bootstrap Icons - BsMouse2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsMouse2Fill
mouse2, outline, mouse, input, device, hardware, computer, pointer, cursor, navigation, peripheral, tech, gaming - Bootstrap Icons - BsMouse2 - SVG | WEBP | PNG | JPG - Icon free download
BsMouse2
mouse3, filled, mouse, input, device, hardware, cursor, pointer, navigation, peripheral, computer, gaming, tech - Bootstrap Icons - BsMouse3Fill - SVG | WEBP | PNG | JPG - Icon free download
BsMouse3Fill
mouse, computer-mouse, pointer, cursor-device, input-device, hardware, usb, bluetooth, click, scroll, device, peripheral, desktop, laptop, mac, windows, linux, workstation, productivity, office, navigation, ui-control - Bootstrap Icons - BsMouse3 - SVG | WEBP | PNG | JPG - Icon free download
BsMouse3
music, note, music-note, beamed-note, audio, sound, song, track, tune, melody, playlist, music-player, media, entertainment, dj, composer, soundtrack - Bootstrap Icons - BsMusicNoteBeamed - SVG | WEBP | PNG | JPG - Icon free download
BsMusicNoteBeamed
music, note, audio, sound, melody, tune, track, song, music-icon, entertainment, media, soundtrack - Bootstrap Icons - BsMusicNote - SVG | WEBP | PNG | JPG - Icon free download
BsMusicNote
music-player, player, audio-player, media-player, filled, sound, track, song, device, music-ui, controls, playback, playlist - Bootstrap Icons - BsMusicPlayerFill - SVG | WEBP | PNG | JPG - Icon free download
BsMusicPlayerFill
music-player, audio-player, media-player, playback, control, sound, song, track, media, entertainment, interface - Bootstrap Icons - BsMusicPlayer - SVG | WEBP | PNG | JPG - Icon free download
BsMusicPlayer
node, minus, collapse, tree-node, hierarchy, navigation, structure, ui, menu, editor, remove - Bootstrap Icons - BsNodeMinus - SVG | WEBP | PNG | JPG - Icon free download
BsNodeMinus
pc, display, horizontal, monitor, screen, desktop, computer, hardware, ui, workspace, device - Bootstrap Icons - BsPcDisplayHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsPcDisplayHorizontal
pc, display, monitor, desktop, screen, computer, hardware, device, ui, workspace - Bootstrap Icons - BsPcDisplay - SVG | WEBP | PNG | JPG - Icon free download
BsPcDisplay
pc, horizontal, screen, monitor, computer, desktop, device, hardware, ui - Bootstrap Icons - BsPcHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsPcHorizontal
pc, computer, desktop, workstation, monitor, device, hardware, screen, setup, tech, ui, dashboard, sidebar, toolbar, windows, linux, mac, developer, coding, work - Bootstrap Icons - BsPc - SVG | WEBP | PNG | JPG - Icon free download
BsPc
person, x, user-remove, user-delete, reject, cancel, block, deny, profile, avatar, human, error, alert, ui, ux, navigation, menu - Bootstrap Icons - BsPersonX - SVG | WEBP | PNG | JPG - Icon free download
BsPersonX
pin, map, map-pin, location, place, marker, geolocation, gps, navigation, travel, destination, poi, map-marker, ui, map-tool - Bootstrap Icons - BsPinMapFill - SVG | WEBP | PNG | JPG - Icon free download
BsPinMapFill
pin, map, pin-map, location, marker, place, geotag, waypoint, map-pin, navigation, gps, poi, address, position, route, travel, direction, map-marker, android, ios, ui, button, sidebar, menu - Bootstrap Icons - BsPinMap - SVG | WEBP | PNG | JPG - Icon free download
BsPinMap
radar, scan, signal, detect, tracking, range, circle, waves, sensor, iot, motion, search, locate, find, outline, device - Bootstrap Icons - BsRadar - SVG | WEBP | PNG | JPG - Icon free download
BsRadar
repeat, repeat-1, one, loop, single-loop, media, audio, video, track, song, music, playback, rewind, forward, player, controls, button, ui, ux, toolbar, sidebar, navigation, ios, android, web, component, icon - Bootstrap Icons - BsRepeat1 - SVG | WEBP | PNG | JPG - Icon free download
BsRepeat1
repeat, loop, cycle, replay, redo, media, audio, video, playback, controls, ui, ux, button, toolbar, navigation, refresh, sync, cycle-action, rotate, player, track, music - Bootstrap Icons - BsRepeat - SVG | WEBP | PNG | JPG - Icon free download
BsRepeat
rewind, rewind-btn, backward, media, audio, video, song, track, player, controls, button, filled, ui, ux, toolbar, skip-back, fast-backward - Bootstrap Icons - BsRewindBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsRewindBtnFill
rewind, rewind-btn, backward, skip-back, media, audio, video, track, player, controls, button, outline, ui, ux, toolbar, navigation - Bootstrap Icons - BsRewindBtn - SVG | WEBP | PNG | JPG - Icon free download
BsRewindBtn
rewind, rewind-circle, circle, backward, media, audio, video, player, controls, icon, button, ui, ux, skip-back, navigation - Bootstrap Icons - BsRewindCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsRewindCircleFill
rewind, rewind-circle, circle, backward, media, audio, video, track, controls, outline, ui, ux, player, navigation - Bootstrap Icons - BsRewindCircle - SVG | WEBP | PNG | JPG - Icon free download
BsRewindCircle
rewind, backward, media, audio, video, track, filled, player, controls, skip-back, button, ui, ux, navigation - Bootstrap Icons - BsRewindFill - SVG | WEBP | PNG | JPG - Icon free download
BsRewindFill
rewind, backward, media, audio, video, track, outline, controls, player, skip-back, navigation, ui, ux - Bootstrap Icons - BsRewind - SVG | WEBP | PNG | JPG - Icon free download
BsRewind
rocket, launch, startup, growth, boost, acceleration, filled, space, ship, takeoff, innovate, progress, speed, branding, business, development, icon, ui - Bootstrap Icons - BsRocketFill - SVG | WEBP | PNG | JPG - Icon free download
BsRocketFill
rocket, takeoff, launch, startup, space, ship, boost, acceleration, growth, filled, lift-off, innovation, progress, business, ui, ux - Bootstrap Icons - BsRocketTakeoffFill - SVG | WEBP | PNG | JPG - Icon free download
BsRocketTakeoffFill
rocket, takeoff, launch, lift-off, startup, innovation, growth, space, ship, outline, speed, progress, accelerate, boost, ui, ux - Bootstrap Icons - BsRocketTakeoff - SVG | WEBP | PNG | JPG - Icon free download
BsRocketTakeoff
rocket, launch, startup, space, ship, speed, innovation, boost, progress, outline, ui, ux, growth, expansion - Bootstrap Icons - BsRocket - SVG | WEBP | PNG | JPG - Icon free download
BsRocket
scooter, vehicle, ride, bike, transport, delivery, mobility, travel, commute, e-scooter - Bootstrap Icons - BsScooter - SVG | WEBP | PNG | JPG - Icon free download
BsScooter
segmented, nav, navigation, tabs, menu, switcher, toggle, ui-element, layout, control, toolbar - Bootstrap Icons - BsSegmentedNav - SVG | WEBP | PNG | JPG - Icon free download
BsSegmentedNav
sign, dead, end, dead-end, dead-end-sign, road-sign, traffic, warning, filled, stop, no-entry, navigation, map, route, gps, location, alert, hazard, safety - Bootstrap Icons - BsSignDeadEndFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignDeadEndFill
sign, dead, end, dead-end, road-sign, traffic, warning, map, navigation, route, gps, location, alert, routing, transport, navigation-icon, direction - Bootstrap Icons - BsSignDeadEnd - SVG | WEBP | PNG | JPG - Icon free download
BsSignDeadEnd
sign, do, not, enter, do-not-enter, no-entry, prohibited, forbidden, traffic, road-sign, filled, warning, access-denied, block, security, map, location, route, alert - Bootstrap Icons - BsSignDoNotEnterFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignDoNotEnterFill
sign, do, not, enter, do-not-enter, no-entry, prohibited, forbidden, traffic, road-sign, map, navigation, access-denied, block, security, warning, location, route - Bootstrap Icons - BsSignDoNotEnter - SVG | WEBP | PNG | JPG - Icon free download
BsSignDoNotEnter
sign, intersection, crossing, road-intersection, traffic, map, navigation, filled, junction, route, gps, direction, warning, safety, transport - Bootstrap Icons - BsSignIntersectionFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignIntersectionFill
sign, intersection, side, side-intersection, junction, road, traffic, map, navigation, filled, route, gps, warning, safety, transport, direction - Bootstrap Icons - BsSignIntersectionSideFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignIntersectionSideFill
sign, intersection, side, side-intersection, road, junction, map, navigation, traffic, route, gps, warning, location, direction, transport - Bootstrap Icons - BsSignIntersectionSide - SVG | WEBP | PNG | JPG - Icon free download
BsSignIntersectionSide
sign, intersection, t, t-intersection, junction, crossing, traffic, map, navigation, filled, route, direction, gps, warning, transport, location - Bootstrap Icons - BsSignIntersectionTFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignIntersectionTFill
sign, intersection, t, t-intersection, junction, crossing, traffic, navigation, map, route, gps, direction, warning, transport, location - Bootstrap Icons - BsSignIntersectionT - SVG | WEBP | PNG | JPG - Icon free download
BsSignIntersectionT
sign, intersection, y, y-intersection, fork, junction, traffic, map, navigation, filled, route, direction, gps, warning, transport, location - Bootstrap Icons - BsSignIntersectionYFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignIntersectionYFill
sign, intersection, y, y-intersection, fork, junction, map, navigation, traffic, route, gps, direction, warning, transport, location - Bootstrap Icons - BsSignIntersectionY - SVG | WEBP | PNG | JPG - Icon free download
BsSignIntersectionY
sign, intersection, crossing, junction, road, map, navigation, traffic, route, gps, direction, warning, transport, location - Bootstrap Icons - BsSignIntersection - SVG | WEBP | PNG | JPG - Icon free download
BsSignIntersection
sign, merge, left, merge-left, lane-merge, traffic, road-sign, map, navigation, filled, route, gps, direction, warning, transport, safety - Bootstrap Icons - BsSignMergeLeftFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignMergeLeftFill
sign, merge, left, merge-left, lane-merge, traffic, road, map, navigation, route, gps, direction, warning, transport - Bootstrap Icons - BsSignMergeLeft - SVG | WEBP | PNG | JPG - Icon free download
BsSignMergeLeft
sign, merge, right, merge-right, lane-merge, traffic, road-sign, map, navigation, filled, route, gps, direction, warning, transport, safety - Bootstrap Icons - BsSignMergeRightFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignMergeRightFill
sign, merge, right, merge-right, lane-merge, traffic, road, map, navigation, route, gps, direction, warning, transport - Bootstrap Icons - BsSignMergeRight - SVG | WEBP | PNG | JPG - Icon free download
BsSignMergeRight
sign, no, left, turn, no-left-turn, prohibition, traffic, road-sign, filled, restriction, map, navigation, route, warning, safety, direction - Bootstrap Icons - BsSignNoLeftTurnFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignNoLeftTurnFill
no-left-turn, left-turn, prohibited, restriction, turning, road, traffic, navigation, transport, street, map, danger, warning, direction, control, highway, intersection, sign, ui-icon, outline - Bootstrap Icons - BsSignNoLeftTurn - SVG | WEBP | PNG | JPG - Icon free download
BsSignNoLeftTurn
no-parking, parking-restriction, restriction, prohibited, p-zone, parking, car, vehicle, traffic, transport, city, urban, signage, filled-icon, map, navigation, alert - Bootstrap Icons - BsSignNoParkingFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignNoParkingFill
no-parking, parking-restriction, restriction, prohibited, p-zone, parking, vehicle, car, transport, map, navigation, street, city, road, outline, sign - Bootstrap Icons - BsSignNoParking - SVG | WEBP | PNG | JPG - Icon free download
BsSignNoParking
no-right-turn, right-turn, prohibited, restriction, turning, road, traffic, transport, navigation, map, intersection, danger, warning, filled-sign - Bootstrap Icons - BsSignNoRightTurnFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignNoRightTurnFill
no-right-turn, right-turn, restriction, prohibited, traffic, road, transport, navigation, direction, map, sign, outline - Bootstrap Icons - BsSignNoRightTurn - SVG | WEBP | PNG | JPG - Icon free download
BsSignNoRightTurn
railroad, rail-crossing, train, railway, track, transport, travel, traffic, warning, sign, filled, station, map, navigation - Bootstrap Icons - BsSignRailroadFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignRailroadFill
railroad, rail-crossing, train, railway, track, warning, transport, navigation, map, sign, outline - Bootstrap Icons - BsSignRailroad - SVG | WEBP | PNG | JPG - Icon free download
BsSignRailroad
stop, stop-sign, halt, traffic, warning, alert, attention, transport, road, intersection, signage, filled - Bootstrap Icons - BsSignStopFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignStopFill
stoplights, traffic-lights, signal, red-light, green-light, yellow-light, intersection, road, transport, control, stop, go, warning, filled - Bootstrap Icons - BsSignStopLightsFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignStopLightsFill
stoplights, traffic-lights, signal, intersection, road, traffic, transport, red, yellow, green, outline, control - Bootstrap Icons - BsSignStopLights - SVG | WEBP | PNG | JPG - Icon free download
BsSignStopLights
stop, stop-sign, halt, warning, alert, road, intersection, traffic, transport, outline, sign - Bootstrap Icons - BsSignStop - SVG | WEBP | PNG | JPG - Icon free download
BsSignStop
turn-left, left-arrow, left-direction, navigation, map, transport, road, intersection, turn, sign, filled - Bootstrap Icons - BsSignTurnLeftFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignTurnLeftFill
turn-left, left-direction, left-arrow, transport, navigation, map, road, intersection, outline, sign - Bootstrap Icons - BsSignTurnLeft - SVG | WEBP | PNG | JPG - Icon free download
BsSignTurnLeft
turn-right, right-direction, right-arrow, navigation, map, transport, road, intersection, turn, filled, sign - Bootstrap Icons - BsSignTurnRightFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignTurnRightFill
turn-right, right-arrow, right-direction, navigation, road, transport, map, turn, outline, sign - Bootstrap Icons - BsSignTurnRight - SVG | WEBP | PNG | JPG - Icon free download
BsSignTurnRight
slight-left, turn-slight-left, gentle-turn, navigation, map, direction, road, transport, intersection, filled, sign - Bootstrap Icons - BsSignTurnSlightLeftFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignTurnSlightLeftFill
slight-left, turn-slight-left, navigation, map, direction, road, transport, outline, sign - Bootstrap Icons - BsSignTurnSlightLeft - SVG | WEBP | PNG | JPG - Icon free download
BsSignTurnSlightLeft
slight-right, turn-slight-right, gentle-turn, navigation, map, direction, road, transport, filled, sign - Bootstrap Icons - BsSignTurnSlightRightFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignTurnSlightRightFill
slight-right, turn-slight-right, navigation, map, direction, road, transport, outline, sign - Bootstrap Icons - BsSignTurnSlightRight - SVG | WEBP | PNG | JPG - Icon free download
BsSignTurnSlightRight
yield, give-way, priority, traffic, road, transport, warning, alert, triangle-sign, intersection, filled - Bootstrap Icons - BsSignYieldFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignYieldFill
sign, yield, traffic, road, caution, warning, triangle, navigation, street, intersection, highway, driving, alert, notice, ui, symbol, line, thin - Bootstrap Icons - BsSignYield - SVG | WEBP | PNG | JPG - Icon free download
BsSignYield
signpost, signpost2, direction, arrow, travel, navigation, guide, location, map, path, tourism, street, road, filled, marker, wayfinding, pointer - Bootstrap Icons - BsSignpost2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsSignpost2Fill
signpost, signpost2, direction, arrow, navigation, guide, travel, map, pointer, wayfinding, route, path, street, tourism, line - Bootstrap Icons - BsSignpost2 - SVG | WEBP | PNG | JPG - Icon free download
BsSignpost2
signpost, direction, arrow, navigation, travel, guide, route, map, location, wayfinding, street, filled, pointer - Bootstrap Icons - BsSignpostFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignpostFill
signpost, split, direction, split-route, navigation, route, map, pointer, travel, guide, marker, filled, wayfinding - Bootstrap Icons - BsSignpostSplitFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignpostSplitFill
signpost, split, navigation, direction, branch, route, map, pointer, guide, street, wayfinding, line - Bootstrap Icons - BsSignpostSplit - SVG | WEBP | PNG | JPG - Icon free download
BsSignpostSplit
signpost, direction, arrow, guide, navigation, map, pointer, route, travel, wayfinding, street, indicator, line - Bootstrap Icons - BsSignpost - SVG | WEBP | PNG | JPG - Icon free download
BsSignpost
skip, backward, button, media, control, rewind, audio, video, player, previous, track, filled, ui, playback - Bootstrap Icons - BsSkipBackwardBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackwardBtnFill
skip, backward, button, media, control, rewind, audio, video, player, previous, track, line, playback - Bootstrap Icons - BsSkipBackwardBtn - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackwardBtn
skip, backward, circle, media, control, rewind, previous, track, audio, video, player, filled, round - Bootstrap Icons - BsSkipBackwardCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackwardCircleFill
skip, backward, circle, media, control, rewind, audio, video, player, previous, track, line, round - Bootstrap Icons - BsSkipBackwardCircle - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackwardCircle
skip, backward, rewind, media, control, audio, video, player, previous, track, filled, playback - Bootstrap Icons - BsSkipBackwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackwardFill
skip, backward, rewind, media, control, audio, video, previous, track, player, line, playback - Bootstrap Icons - BsSkipBackward - SVG | WEBP | PNG | JPG - Icon free download
BsSkipBackward
skip, end, button, media, control, fast-forward, next, track, audio, video, player, filled, playback - Bootstrap Icons - BsSkipEndBtnFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipEndBtnFill
skip, end, skip-end, button, media, control, next, forward, end-track, move-end, player, audio, video, playlist, toolbar, ui, navigation, icon-button, track-end, song-end, episode-end, skip-button, media-skip, media-next, compact-control, ios, android, web - Bootstrap Icons - BsSkipEndBtn - SVG | WEBP | PNG | JPG - Icon free download
BsSkipEndBtn
skip, end, circle, filled, skip-end, media, control, circle-button, round-icon, playlist, forward, next, track-end, ui, player, audio-control, video-control, skip-circle, navigation, media-next, media-skip, round-control, hover-control - Bootstrap Icons - BsSkipEndCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipEndCircleFill
skip, end, skip-end, line, media, control, next, forward, track-end, playlist, audio, video, media-skip, media-next, navigation, thin-icon, player-control, ui, media-navigation, simple-control - Bootstrap Icons - BsSkipEnd - SVG | WEBP | PNG | JPG - Icon free download
BsSkipEnd
skip, forward, circle, filled, skip-forward, media, control, next, advance, round, track-forward, audio, video, playlist, player, media-next, media-skip, circular-button, ui-control, navigation, media-icon, round-filled - Bootstrap Icons - BsSkipForwardCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipForwardCircleFill
skip, forward, filled, skip-forward, media, control, next, track-forward, advance, audio, video, playlist, player, media-skip, media-next, bold-control, compact-control, ui, navigation - Bootstrap Icons - BsSkipForwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsSkipForwardFill
skip, forward, line, skip-forward, media, control, next, advance, track-forward, playlist, audio, video, ui, media-next, media-skip, navigation, minimal-control - Bootstrap Icons - BsSkipForward - SVG | WEBP | PNG | JPG - Icon free download
BsSkipForward
skip, start, line, skip-start, media, control, previous, back, track-start, audio, video, playlist, player, ui, minimal-icon, media-prev, media-back, navigation - Bootstrap Icons - BsSkipStart - SVG | WEBP | PNG | JPG - Icon free download
BsSkipStart
speedometer, gauge, meter, speed, performance, dashboard, indicator, monitor, stats, analytics, needle, ui, measurement - Bootstrap Icons - BsSpeedometer - SVG | WEBP | PNG | JPG - Icon free download
BsSpeedometer
speedometer, gauge, meter, speed, performance, monitor, dash, indicator, needle, stats, ui, analytics, measurement, variant - Bootstrap Icons - BsSpeedometer2 - SVG | WEBP | PNG | JPG - Icon free download
BsSpeedometer2
stoplights, traffic-light, signal, filled, red-light, green-light, yellow-light, intersection, traffic, stop, go, caution, transport, road - Bootstrap Icons - BsStoplightsFill - SVG | WEBP | PNG | JPG - Icon free download
BsStoplightsFill
stoplights, traffic-light, signal, intersection, outline, red-light, green-light, yellow-light, stop, go, caution, road, transport, navigation - Bootstrap Icons - BsStoplights - SVG | WEBP | PNG | JPG - Icon free download
BsStoplights
stopwatch, timer, clock, filled, time, countdown, measure, interval, track, sport, performance, schedule, ui, dashboard - Bootstrap Icons - BsStopwatchFill - SVG | WEBP | PNG | JPG - Icon free download
BsStopwatchFill
stopwatch, timer, clock, outline, time, countdown, measure, interval, sport, track, schedule, ui, dashboard - Bootstrap Icons - BsStopwatch - SVG | WEBP | PNG | JPG - Icon free download
BsStopwatch
strava, brand, fitness, tracking, run, cycle, exercise, workout, community, sport, gps, map, health, activity, logo, brand-logo - Bootstrap Icons - BsStrava - SVG | WEBP | PNG | JPG - Icon free download
BsStrava
suitcase, luggage, bag, travel, trip, journey, tour, filled, carry, work-travel, vacation, holidays, business-trip, baggage - Bootstrap Icons - BsSuitcaseFill - SVG | WEBP | PNG | JPG - Icon free download
BsSuitcaseFill
taxi, car, cab, transport, vehicle, ride, travel, pickup, front-view, filled - Bootstrap Icons - BsTaxiFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsTaxiFrontFill
taxi, cab, car, transport, vehicle, ride, front-view, outline - Bootstrap Icons - BsTaxiFront - SVG | WEBP | PNG | JPG - Icon free download
BsTaxiFront
telephone, inbound, incoming, phone, receiver, inbound-call, contact, ring, connect, support, customer-service, call-center, outline, ui, button, navigation, android, ios - Bootstrap Icons - BsTelephoneInbound - SVG | WEBP | PNG | JPG - Icon free download
BsTelephoneInbound
text, indent, indent-right, format, align, paragraph, spacing, editor, rich-text, document, layout, ui, toolbar, button, writing, content, toggle, navigation, sidebar, shift, move, arrow, ios, android, web - Bootstrap Icons - BsTextIndentRight - SVG | WEBP | PNG | JPG - Icon free download
BsTextIndentRight
thermometer, half, temperature, medium, heat, cool, sensor, climate, weather, health, fever, measurement, device, monitor, environment, temperature-reading, ios, android - Bootstrap Icons - BsThermometerHalf - SVG | WEBP | PNG | JPG - Icon free download
BsThermometerHalf
thermometer, high, temperature, hot, heat, warning, sensor, climate, weather, health, fever, environment, monitor, reading, alert, ios, android - Bootstrap Icons - BsThermometerHigh - SVG | WEBP | PNG | JPG - Icon free download
BsThermometerHigh
thermometer, low, temperature, cold, cool, freeze, sensor, climate, weather, monitor, reading, environment, alert, ios, android - Bootstrap Icons - BsThermometerLow - SVG | WEBP | PNG | JPG - Icon free download
BsThermometerLow
thermometer, temperature, sensor, measurement, climate, weather, reading, monitor, environment, health, fever, tool, device, ios, android - Bootstrap Icons - BsThermometer - SVG | WEBP | PNG | JPG - Icon free download
BsThermometer
three-dots, vertical, more, options, menu, overflow, actions, kebab-menu, ui, button, navigation, toolbar, settings, context-menu, toggle, ios, android, web - Bootstrap Icons - BsThreeDotsVertical - SVG | WEBP | PNG | JPG - Icon free download
BsThreeDotsVertical
three-dots, horizontal, more, options, menu, overflow, actions, ui, navigation, toolbar, context-menu, ellipsis, button, ios, android, web - Bootstrap Icons - BsThreeDots - SVG | WEBP | PNG | JPG - Icon free download
BsThreeDots
train, freight, front, filled, cargo, rail, locomotive, transport, shipping, logistics, delivery, supply-chain, railway, train-filled - Bootstrap Icons - BsTrainFreightFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsTrainFreightFrontFill
train, freight, front, outline, cargo, rail, locomotive, transport, shipping, logistics, railway, delivery, train-outline - Bootstrap Icons - BsTrainFreightFront - SVG | WEBP | PNG | JPG - Icon free download
BsTrainFreightFront
train, front, filled, rail, locomotive, subway, metro, transit, public-transport, travel, commute, transport - Bootstrap Icons - BsTrainFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsTrainFrontFill
train, front, outline, transit, rail, locomotive, metro, subway, commute, public-transport, travel, transport - Bootstrap Icons - BsTrainFront - SVG | WEBP | PNG | JPG - Icon free download
BsTrainFront
train, light-rail, lightrail, front, filled, metro, tram, subway, transit, public-transport, travel, commute, transport - Bootstrap Icons - BsTrainLightrailFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsTrainLightrailFrontFill
truck, flatbed, delivery, cargo, transport, vehicle, shipping - Bootstrap Icons - BsTruckFlatbed - SVG | WEBP | PNG | JPG - Icon free download
BsTruckFlatbed
truck, front, delivery, cargo, transport, vehicle, freight - Bootstrap Icons - BsTruckFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsTruckFrontFill
truck, front, truck-front, vehicle, lorry, cargo, transport, delivery, logistics, freight, shipping, supply-chain, transportation, driver, automotive, fleet, road, highway, map-marker, route, ecommerce, warehouse - Bootstrap Icons - BsTruckFront - SVG | WEBP | PNG | JPG - Icon free download
BsTruckFront
truck, vehicle, lorry, cargo, freight, delivery, shipping, transport, logistics, supply-chain, transportation, route, ecommerce, warehouse, fleet, road - Bootstrap Icons - BsTruck - SVG | WEBP | PNG | JPG - Icon free download
BsTruck
tv, television, screen, display, monitor, media, video, movie, streaming, entertainment, device, electronics, filled, dashboard-widget - Bootstrap Icons - BsTvFill - SVG | WEBP | PNG | JPG - Icon free download
BsTvFill
tv, television, screen, display, monitor, media, video, movie, streaming, entertainment, device, electronics, outline - Bootstrap Icons - BsTv - SVG | WEBP | PNG | JPG - Icon free download
BsTv
union, shape, boolean, merge, combine, geometry, design, vector, path, graphics, tool, layout - Bootstrap Icons - BsUnion - SVG | WEBP | PNG | JPG - Icon free download
BsUnion
upc, scan, upc-scan, barcode, scanner, inventory, retail, checkout, pos, shop, tracking, product-id - Bootstrap Icons - BsUpcScan - SVG | WEBP | PNG | JPG - Icon free download
BsUpcScan
vector, pen, vector-pen, design, draw, edit, graphic, illustration, art, curve, path, svg, creative, designer, ui, toolbar, outline, edit-tool - Bootstrap Icons - BsVectorPen - SVG | WEBP | PNG | JPG - Icon free download
BsVectorPen
view, list, view-list, items, rows, menu, layout, navigation, organize, display, ui, sidebar, toolbar, outline, table, content - Bootstrap Icons - BsViewList - SVG | WEBP | PNG | JPG - Icon free download
BsViewList
view, stacked, view-stacked, layers, cards, tiles, layout, ui, stack, column, organize, content, outline, navigation, dashboard - Bootstrap Icons - BsViewStacked - SVG | WEBP | PNG | JPG - Icon free download
BsViewStacked
vinyl, record, disc, music, audio, retro, analog, sound, playlist, album, turntable, filled, media, entertainment, track - Bootstrap Icons - BsVinylFill - SVG | WEBP | PNG | JPG - Icon free download
BsVinylFill
vinyl, record, disc, music, audio, retro, sound, analog, album, turntable, outline, media, track, playlist - Bootstrap Icons - BsVinyl - SVG | WEBP | PNG | JPG - Icon free download
BsVinyl
desktop, window, computer, monitor, ui-window, screen, os, system, app-window, layout - Bootstrap Icons - BsWindowDesktop - SVG | WEBP | PNG | JPG - Icon free download
BsWindowDesktop
window, sidebar, panel, navigation, layout, ui-window, menu, desktop, container, sections - Bootstrap Icons - BsWindowSidebar - SVG | WEBP | PNG | JPG - Icon free download
BsWindowSidebar
airplane, flight, plane, travel, trip, journey, airport, airline, takeoff, landing, navigation, transport, booking, ticket, vacation, holiday, route, destination, tourism - css.gg Icons - CgAirplane - SVG | WEBP | PNG | JPG - Icon free download
CgAirplane
anchor, ship, boat, nautical, marine, sea, sailing, dock, harbor, navigation, maritime, symbol - css.gg Icons - CgAnchor - SVG | WEBP | PNG | JPG - Icon free download
CgAnchor
arrow, bottom-left, diagonal, navigation, direction, outline-arrow, corner, move, pointer, ui, map-direction - css.gg Icons - CgArrowBottomLeftO - SVG | WEBP | PNG | JPG - Icon free download
CgArrowBottomLeftO
arrow, bottom-left, diagonal, direction, navigation, regular-arrow, pointer, move, corner, ui, map - css.gg Icons - CgArrowBottomLeftR - SVG | WEBP | PNG | JPG - Icon free download
CgArrowBottomLeftR
arrow, bottom-left, diagonal, move, pointer, direction, navigation, corner, ui, indicator - css.gg Icons - CgArrowBottomLeft - SVG | WEBP | PNG | JPG - Icon free download
CgArrowBottomLeft
arrow, bottom-right, diagonal, outline-arrow, direction, move, navigation, pointer, ui, corner - css.gg Icons - CgArrowBottomRightO - SVG | WEBP | PNG | JPG - Icon free download
CgArrowBottomRightO
arrow, long, down, long-down, scroll, direction, ui, navigation, pointer - css.gg Icons - CgArrowLongDownC - SVG | WEBP | PNG | JPG - Icon free download
CgArrowLongDownC
battery, power, energy, charge, device, indicator, status, monitor - css.gg Icons - CgBattery - SVG | WEBP | PNG | JPG - Icon free download
CgBattery
bmw, brand, car, automotive, vehicle, logo, luxury, transport, motor, company - css.gg Icons - CgBmw - SVG | WEBP | PNG | JPG - Icon free download
CgBmw
box, package, parcel, shipping, delivery, container, inventory, storage, crate, logistics, ecommerce, warehouse, product-package - css.gg Icons - CgBox - SVG | WEBP | PNG | JPG - Icon free download
CgBox
browse, explore, navigation, search, discover, directory, file-browse, content, view, ui-action, internet, website - css.gg Icons - CgBrowse - SVG | WEBP | PNG | JPG - Icon free download
CgBrowse
browser, web, internet, window, tab, site, webpage, ui, internet-app, navigation, address-bar, developer-tool, frontend - css.gg Icons - CgBrowser - SVG | WEBP | PNG | JPG - Icon free download
CgBrowser
calendar, today, current-day, highlight, date, event, daily, schedule, planner, tasks, navigation - css.gg Icons - CgCalendarToday - SVG | WEBP | PNG | JPG - Icon free download
CgCalendarToday
carousel, slider, gallery, slideshow, media-slider, ui-component, navigation, rotate, scroll, banner, image-rotation - css.gg Icons - CgCarousel - SVG | WEBP | PNG | JPG - Icon free download
CgCarousel
chevron, double-down, down, arrow, expand, scroll, move-down, more, dropdown, outline-arrow, navigation, ui, caret, collapse, accordion - css.gg Icons - CgChevronDoubleDownO - SVG | WEBP | PNG | JPG - Icon free download
CgChevronDoubleDownO
chevron, double-down, down, arrow, regular-arrow, expand, dropdown, open, scroll, ui, caret, move-down, navigation - css.gg Icons - CgChevronDoubleDownR - SVG | WEBP | PNG | JPG - Icon free download
CgChevronDoubleDownR
double-down, chevron, arrow, down, scroll, expand, dropdown, open, caret, ui, navigation, move-down - css.gg Icons - CgChevronDoubleDown - SVG | WEBP | PNG | JPG - Icon free download
CgChevronDoubleDown
cg, chevron, up, chevron-up, up-chevron, up-arrow, collapse, expand, scroll-up, back-to-top, accordion, dropdown, outline, button, icon-button, navigation, ui - css.gg Icons - CgChevronUpO - SVG | WEBP | PNG | JPG - Icon free download
CgChevronUpO
compress, left, compress-left, shrink, collapse, arrow-left, side-collapse, ui-control, panel, layout, resize, compact, sidebar-hide, direction, navigation - css.gg Icons - CgCompressLeft - SVG | WEBP | PNG | JPG - Icon free download
CgCompressLeft
compress, right, compress-right, shrink, collapse, arrow-right, side-collapse, ui-control, panel, layout, resize, compact, sidebar-hide, direction, navigation - css.gg Icons - CgCompressRight - SVG | WEBP | PNG | JPG - Icon free download
CgCompressRight
corner, double, down, left, double-down-left, arrow, direction, navigation, ui, movement, turn, rotate, path, pointer - css.gg Icons - CgCornerDoubleDownLeft - SVG | WEBP | PNG | JPG - Icon free download
CgCornerDoubleDownLeft
corner, double, down, right, double-down-right, arrow, direction, navigation, ui, movement, turn, pointer, path - css.gg Icons - CgCornerDoubleDownRight - SVG | WEBP | PNG | JPG - Icon free download
CgCornerDoubleDownRight
corner, double, left, down, double-left-down, arrow, navigation, direction, ui, pointer, movement, path, turn - css.gg Icons - CgCornerDoubleLeftDown - SVG | WEBP | PNG | JPG - Icon free download
CgCornerDoubleLeftDown
corner, double, left, up, double-left-up, arrow, direction, navigation, ui, movement, path, pointer - css.gg Icons - CgCornerDoubleLeftUp - SVG | WEBP | PNG | JPG - Icon free download
CgCornerDoubleLeftUp
corner, double, right, down, double-right-down, arrow, navigation, direction, ui, movement, path, turn - css.gg Icons - CgCornerDoubleRightDown - SVG | WEBP | PNG | JPG - Icon free download
CgCornerDoubleRightDown
corner, double, right, up, double-right-up, arrow, direction, navigation, ui, movement, path, pointer - css.gg Icons - CgCornerDoubleRightUp - SVG | WEBP | PNG | JPG - Icon free download
CgCornerDoubleRightUp
corner, double, up, left, double-up-left, arrow, direction, navigation, movement, ui, pointer, path - css.gg Icons - CgCornerDoubleUpLeft - SVG | WEBP | PNG | JPG - Icon free download
CgCornerDoubleUpLeft
cross, close, cancel, remove, x, delete, stop, clear, dismiss, ui, ux, error, alert, modal-close, badge-close, button, toolbar, navigation, ios, android - css.gg Icons - CgCross - SVG | WEBP | PNG | JPG - Icon free download
CgCross
desktop, computer, monitor, screen, pc, display, workstation, device, setup, ui, window, dashboard, workspace, hardware, electronics, home screen, office desk, system ui, toolbar icon, menu icon, panel, layout, productivity, coding setup, developer tools, tech - css.gg Icons - CgDesktop - SVG | WEBP | PNG | JPG - Icon free download
CgDesktop
details less, collapse, hide, minimize, reduce, less info, toggle, ui, accordion, content hide, panel collapse, menu minimize, dropdown, navigation, toolbar, clean view, compact mode, remove details, minimal layout - css.gg Icons - CgDetailsLess - SVG | WEBP | PNG | JPG - Icon free download
CgDetailsLess
details more, expand, show, more info, toggle, accordion, dropdown, ui, panel expand, open section, navigation, toolbar, information, full view, extended view, content expand, options - css.gg Icons - CgDetailsMore - SVG | WEBP | PNG | JPG - Icon free download
CgDetailsMore
disc, cd, dvd, media, music, album, track, audio, playlist, storage, record, optical disc, collection, file icon, library, sound, player, ui button, toolbox, asset - css.gg Icons - CgDisc - SVG | WEBP | PNG | JPG - Icon free download
CgDisc
dock, left, sidebar, panel, attach, ui layout, navigation, window, position, layout panel, left side, editor, frontend, interface design - css.gg Icons - CgDockLeft - SVG | WEBP | PNG | JPG - Icon free download
CgDockLeft
dock, right, sidebar, panel, attach, ui layout, navigation, window, position, layout panel, right side, editor, frontend, interface design - css.gg Icons - CgDockRight - SVG | WEBP | PNG | JPG - Icon free download
CgDockRight
dock, window, dock window, ui window, panel, sidebar, layout, workspace, desktop, toolbar, modal, frame, ui element, navigation, window manager, app window, window layout, split view, multiwindow, productivity, designer tools, editor, dashboard, interface block, container - css.gg Icons - CgDockWindow - SVG | WEBP | PNG | JPG - Icon free download
CgDockWindow
enter, keyboard enter, return, submit, confirm, proceed, action key, login, access, form submit, navigation, button, ui control, input, shortcut, key press, command, interaction, workflow, continue - css.gg Icons - CgEnter - SVG | WEBP | PNG | JPG - Icon free download
CgEnter
expand, resize, fullscreen, maximize, enlarge, zoom out, layout, window, ui control, open, spread, screen, navigation, button, toolbar, interaction, panel, modal, popout, desktop, mobile, fluid layout - css.gg Icons - CgExpand - SVG | WEBP | PNG | JPG - Icon free download
CgExpand
external, external link, open new tab, link out, arrow, redirect, navigation, open page, browser, resource, reference, outbound, ui, button, action, interaction, hyperlink - css.gg Icons - CgExternal - SVG | WEBP | PNG | JPG - Icon free download
CgExternal
eye, view, show, visibility, preview, look, watch, monitor, reveal, password visibility, see, focus, eye alt, ux, ui, toggle, vision, profile, observation - css.gg Icons - CgEyeAlt - SVG | WEBP | PNG | JPG - Icon free download
CgEyeAlt
eye, view, see, visibility, preview, look, watch, monitor, focus, password toggle, show, display, observe, ux, ui, profile, vision, insight - css.gg Icons - CgEye - SVG | WEBP | PNG | JPG - Icon free download
CgEye
facebook, fb, social media, brand, logo, network, community, share, post, platform, messaging, profile, timeline, social network, meta, promotion, marketing, follow - css.gg Icons - CgFacebook - SVG | WEBP | PNG | JPG - Icon free download
CgFacebook
feed, news, timeline, activity, updates, stream, content, post list, scroll, dashboard, social, ui, menu, sidebar, navigation, widget, ios, android, material - css.gg Icons - CgFeed - SVG | WEBP | PNG | JPG - Icon free download
CgFeed
film, movie, video, cinema, reel, footage, clip, media, recording, entertainment, playback, editor, timeline, camera, multimedia, ios, android - css.gg Icons - CgFilm - SVG | WEBP | PNG | JPG - Icon free download
CgFilm
indent increase, indent, increase indent, format, text, editor, paragraph, spacing, tab, code editor, document formatting, text layout, ui control, toolbar button, alignment, content shift, writing tools, markdown, rich text, header, sidebar, navigation - css.gg Icons - CgFormatIndentIncrease - SVG | WEBP | PNG | JPG - Icon free download
CgFormatIndentIncrease
git, branch, git branch, version control, merge, feature branch, repo, repository, source control, vcs, workflow, collaboration, code flow, tree, development, devops, engineering, commit chain, sidebar, toolbar, header icon, navigation, branching model, pull request, merge request, software - css.gg Icons - CgGitBranch - SVG | WEBP | PNG | JPG - Icon free download
CgGitBranch
git, commit, git commit, checkpoint, version control, repo, repository, vcs, code change, snapshot, source control, dot, commit dot, development, devops, log, history, timeline, code review, engineering, toolbar, status, software - css.gg Icons - CgGitCommit - SVG | WEBP | PNG | JPG - Icon free download
CgGitCommit
globe, globe alt, world, earth, global, international, planet, map, geography, internet, web, www, global access, travel, navigation, location, worldwide, global settings, society, environment, languages, internationalization, i18n, header icon, footer icon - css.gg Icons - CgGlobeAlt - SVG | WEBP | PNG | JPG - Icon free download
CgGlobeAlt
globe, world, earth, planet, international, global, map, geography, internet, www, web, worldwide, i18n, languages, navigation, travel, location, environment, global settings, society, header icon, footer icon - css.gg Icons - CgGlobe - SVG | WEBP | PNG | JPG - Icon free download
CgGlobe
home, alt home, house, main, dashboard, landing, homepage, start, root, navigation, menu, sidebar, footer, tab, mobile nav, ui element - css.gg Icons - CgHomeAlt - SVG | WEBP | PNG | JPG - Icon free download
CgHomeAlt
home screen, mobile, screen, layout, homepage, dashboard, ui, navigation, start, welcome, root page, panel, app home, tablet, smartphone - css.gg Icons - CgHomeScreen - SVG | WEBP | PNG | JPG - Icon free download
CgHomeScreen
home, house, main, dashboard, homepage, navigation, root, menu, sidebar, footer, tab, landing, start, ui - css.gg Icons - CgHome - SVG | WEBP | PNG | JPG - Icon free download
CgHome
insights, analytics, metrics, stats, chart, data, report, business intelligence, overview, dashboard, tracking, performance, visualization, trends, monitoring, kpi, analysis, data tools - css.gg Icons - CgInsights - SVG | WEBP | PNG | JPG - Icon free download
CgInsights
internal, inside, intranet, private, restricted, access, internal link, workflow, system route, navigation, protected, organization, role-based, secure area, ui element - css.gg Icons - CgInternal - SVG | WEBP | PNG | JPG - Icon free download
CgInternal
laptop, computer, notebook, pc, device, workstation, tech, desktop replacement, coding, developer, designer, ui, dashboard, workspace, remote work, portable device, electronics, hardware, screen, monitor, browser, web app, toolbar, menu - css.gg Icons - CgLaptop - SVG | WEBP | PNG | JPG - Icon free download
CgLaptop
load, loadbar, alt, progress, progress bar, indicator, loading, buffer, status, async, background task, file upload, upload, skeleton, placeholder, dashboard, status bar, visual feedback, loader, spinner alternative, ux, web ui, mobile ui, component, widget, task progress, operation status, buffer indicator, media buffer - css.gg Icons - CgLoadbarAlt - SVG | WEBP | PNG | JPG - Icon free download
CgLoadbarAlt
load, loadbar, doc, document, document upload, file, file upload, progress, upload queue, conversion, scan, batch upload, attachment, cms, admin panel, cloud storage, transfer, file manager, status, visual feedback, form attachment, ux, web ui, mobile ui, processing, document status, file processing, upload status, content management - css.gg Icons - CgLoadbarDoc - SVG | WEBP | PNG | JPG - Icon free download
CgLoadbarDoc
load, loadbar, sound, audio, buffering, playback, media, music player, podcast, streaming, upload, audio upload, progress, timeline, scrubbing, equalizer, playback indicator, buffer indicator, media control, visual feedback, ux, web ui, mobile ui, timeline scrub, encoding, sound processing, player ui, audio status, loading state - css.gg Icons - CgLoadbarSound - SVG | WEBP | PNG | JPG - Icon free download
CgLoadbarSound
load, loadbar, progress, progress bar, loading, status, async, background task, page load, update, transfer, file transfer, skeleton, placeholder, visual feedback, loader, widget, component, dashboard, form, media buffer, operation status, ux, web ui, mobile ui, system status, task progress, waiting, buffer - css.gg Icons - CgLoadbar - SVG | WEBP | PNG | JPG - Icon free download
CgLoadbar
menu, boxed menu, grid menu, container menu, navigation, ui menu, hamburger alt, options, list, panel, sidebar, toolbar, header menu, mobile menu, ios, android, web navigation - css.gg Icons - CgMenuBoxed - SVG | WEBP | PNG | JPG - Icon free download
CgMenuBoxed
cheese, menu cheese, food, dairy, slice, snack, restaurant menu, kitchen, hospitality, fun icon, cute icon, ui menu, navigation, food category, grocery, culinary, cheddar - css.gg Icons - CgMenuCheese - SVG | WEBP | PNG | JPG - Icon free download
CgMenuCheese
menu grid, grid o, grid menu, navigation, grid layout, tiles, app launcher, options, dashboard menu, panel, toolbar, ui component, ios, android, web menu, button - css.gg Icons - CgMenuGridO - SVG | WEBP | PNG | JPG - Icon free download
CgMenuGridO
menu, left, alt, left menu, menu left alt, sidebar toggle, drawer open, nav open, navigation, panel, layout control, header, toolbar button, mobile, responsive, svg, cssgg, react-icons, ux, ui, sidebar, toggle - css.gg Icons - CgMenuLeftAlt - SVG | WEBP | PNG | JPG - Icon free download
CgMenuLeftAlt
menu, left, left menu, sidebar toggle, drawer, nav, navigation, panel, menu button, header, toolbar, mobile, responsive, svg, cssgg, react-icons, ux, ui, toggle, open, close - css.gg Icons - CgMenuLeft - SVG | WEBP | PNG | JPG - Icon free download
CgMenuLeft
menu, right, right menu, sidebar toggle, drawer, navigation, panel, menu button, toolbar, header, mobile, responsive, svg, cssgg, react-icons, ux, ui, toggle, open, close - css.gg Icons - CgMenuRight - SVG | WEBP | PNG | JPG - Icon free download
CgMenuRight
menu, cg, hamburger, menu icon, navigation, nav, drawer, sidebar, toggle, menu button, toolbar, header, mobile, responsive, svg, cssgg, react-icons, ux, ui, open, close, interaction, prototype - css.gg Icons - CgMenu - SVG | WEBP | PNG | JPG - Icon free download
CgMenu
minimize, alt minimize, window control, reduce, collapse, shrink, ui action, toolbar, taskbar, modal, dialog, panel, hide, compact, layout control, system, navigation, button - css.gg Icons - CgMinimizeAlt - SVG | WEBP | PNG | JPG - Icon free download
CgMinimizeAlt
minimize, window minimize, collapse, reduce, shrink, ui action, toolbar, system, window, taskbar, modal, dialog, compact mode, panel, hide, layout, navigation, button - css.gg Icons - CgMinimize - SVG | WEBP | PNG | JPG - Icon free download
CgMinimize
monday, day, weekday, calendar, date, schedule, planner, workweek, task, agenda, timeline, events, reminder, organize, office, productivity, ui calendar, workday, week start - css.gg Icons - CgMonday - SVG | WEBP | PNG | JPG - Icon free download
CgMonday
more, r, options, ellipsis, overflow, three dots, menu, context actions, toolbar, ui control, android, ios, navigation, popup - css.gg Icons - CgMoreR - SVG | WEBP | PNG | JPG - Icon free download
CgMoreR
mouse, computer mouse, pointer device, click, scroll, input, hardware, cursor, pc, mac, device control, usb mouse, bluetooth mouse, gaming mouse, navigation, ui interaction, desktop ui - css.gg Icons - CgMouse - SVG | WEBP | PNG | JPG - Icon free download
CgMouse
music note, note, sound, audio, melody, song, track, music icon, tone, beat, playlist, music app, media icon, composer, recording, music library, audio file, music player, ui symbol, material, ios, android - css.gg Icons - CgMusicNote - SVG | WEBP | PNG | JPG - Icon free download
CgMusicNote
music, audio, sound, melody, track, song, playlist, music icon, media, music library, music app, sound symbol, music control, music feature, entertainment, composer, recording, tone, beat, ui icon, material, ios, android - css.gg Icons - CgMusic - SVG | WEBP | PNG | JPG - Icon free download
CgMusic
path back, back, undo, arrow left, navigation, previous, history, return, step back, go back, breadcrumb, ui navigation, toolbar icon, action, hover state, touch control, mobile navigation, left arrow - css.gg Icons - CgPathBack - SVG | WEBP | PNG | JPG - Icon free download
CgPathBack
performance, speed, metrics, analytics, gauge, dashboard, system performance, optimization, boost, kpi, stats, chart, indicator, monitoring, load, benchmark, efficiency, measurement, tracking, ui dashboard, status monitor - css.gg Icons - CgPerformance - SVG | WEBP | PNG | JPG - Icon free download
CgPerformance
play backwards, rewind, reverse, media, audio, video, controller, skip back, back, previous, play control, multimedia, player, timeline, jump back, toolbar, button, ui control - css.gg Icons - CgPlayBackwards - SVG | WEBP | PNG | JPG - Icon free download
CgPlayBackwards
fast forward, forward, skip forward, media forward, play forward, next, jump, advance, media control, playback, video control, audio control, streaming, music, next track, seek, timeline, cta, toolbar action, ios, android, web ui - css.gg Icons - CgPlayForwards - SVG | WEBP | PNG | JPG - Icon free download
CgPlayForwards
playlist, list, media list, track list, video list, audio list, queue, library, collection, songs, videos, multimedia, content list, web ui, ios, android, navigation, menu, sidebar, minimal - css.gg Icons - CgPlayList - SVG | WEBP | PNG | JPG - Icon free download
CgPlayList
play pause, pause toggle, playback control, pause, play, media, audio, video, music, player, toggle, control, transport, streaming, ui button, toolbar action, ios, android, web app, minimal, line icon, outline, playback ui - css.gg Icons - CgPlayPauseR - SVG | WEBP | PNG | JPG - Icon free download
CgPlayPauseR
play pause, pause toggle, playback control, media, audio, video, music, player, toggle, control, transport, streaming, ui, button, playback ui, switch, pause button, play button - css.gg Icons - CgPlayPause - SVG | WEBP | PNG | JPG - Icon free download
CgPlayPause
stop, media stop, playback stop, halt, player control, audio stop, video stop, transport, ui button, line icon, minimal, streaming ui, toolbar action - css.gg Icons - CgPlayStopR - SVG | WEBP | PNG | JPG - Icon free download
CgPlayStopR
stop, media stop, playback stop, halt, end playback, control, audio, video, player, toolbar, button, transport, ui - css.gg Icons - CgPlayStop - SVG | WEBP | PNG | JPG - Icon free download
CgPlayStop
next track, skip forward, track next, next, media, audio, video, music, player, playlist, navigate forward, streaming, line icon, outline, transport, ui button - css.gg Icons - CgPlayTrackNextO - SVG | WEBP | PNG | JPG - Icon free download
CgPlayTrackNextO
next track, track next, skip forward, playlist next, media control, audio, video, skip button, player, streaming, line icon, minimal, transport - css.gg Icons - CgPlayTrackNextR - SVG | WEBP | PNG | JPG - Icon free download
CgPlayTrackNextR
previous track, track prev, skip back, go back, media control, audio, video, player, playlist, outline icon, minimal, transport, skip backward - css.gg Icons - CgPlayTrackPrevO - SVG | WEBP | PNG | JPG - Icon free download
CgPlayTrackPrevO
previous track, track prev, skip backward, playlist back, media, audio, video, player, rewind, navigate back, line icon, transport, toolbar action - css.gg Icons - CgPlayTrackPrevR - SVG | WEBP | PNG | JPG - Icon free download
CgPlayTrackPrevR
play previous, track prev, previous, back, rewind, media, audio, video, player, controls, skip back, music, playlist, navigation, toolbar, button, ui, ios, android, web player, seek, media action, hover state, active state - css.gg Icons - CgPlayTrackPrev - SVG | WEBP | PNG | JPG - Icon free download
CgPlayTrackPrev
profile, user, account, avatar, person, identity, login, account settings, member, contact, personal info, dashboard, account page, ui, navigation, header - css.gg Icons - CgProfile - SVG | WEBP | PNG | JPG - Icon free download
CgProfile
record, recording, media, audio, video, mic, capture, start recording, button, red dot, ui control, media tool, screen record, voice memo, content creation, editor, streaming, timeline, media panel, android, ios - css.gg Icons - CgRecord - SVG | WEBP | PNG | JPG - Icon free download
CgRecord
redo, repeat, forward action, restore, reapply, edit, history, action step, ui control, toolbar button, editor tool, timeline, undo redo, workflow, command, android, ios, cursor action, shortcut - css.gg Icons - CgRedo - SVG | WEBP | PNG | JPG - Icon free download
CgRedo
screenshot, screen shot, capture screen, capture, snapshot, screen capture, monitor, display, grab, ui tool, toolbar, button, action, frame, crop, selection, snip, snipping, windows capture, mac capture, ios, android, overlay, record, save, export, utility - css.gg Icons - CgScreenShot - SVG | WEBP | PNG | JPG - Icon free download
CgScreenShot
wide screen, screen wide, monitor, display, widescreen, ultrawide, desktop, resolution, aspect ratio, landscape, tv, presentation, workspace, layout, frame, panel, ui frame, window, hardware, device - css.gg Icons - CgScreenWide - SVG | WEBP | PNG | JPG - Icon free download
CgScreenWide
screen, monitor, display, desktop, device, frame, window, layout, resolution, panel, tv, presentation, workstation, ui, hardware, system panel, viewport, app window - css.gg Icons - CgScreen - SVG | WEBP | PNG | JPG - Icon free download
CgScreen
scroll horizontal, horizontal scroll, scroll h, pan horizontal, drag, swipe, gesture, carousel, slider, timeline, movement, viewport, overflow, content navigation, ui control, arrows, scroll bar, touch interaction - css.gg Icons - CgScrollH - SVG | WEBP | PNG | JPG - Icon free download
CgScrollH
smartphone, phone, mobile, device, cellphone, touchscreen, handheld, communication, call, sms, app, ios, android, ui icon, navigation, toolbar, mobile device, electronics - css.gg Icons - CgSmartphone - SVG | WEBP | PNG | JPG - Icon free download
CgSmartphone
sort, a-z, alphabetical, sort ascending, text sorting, organize, list, table header, filter, search tool, alphabet, ui control, toolbar, data management, file list, index, navigation - css.gg Icons - CgSortAz - SVG | WEBP | PNG | JPG - Icon free download
CgSortAz
spinner, loading, progress, waiting, loader, activity, refresh, busy, pending, async, ui feedback, status indicator, minimal loader, circle loader, loading state, transition, progress ring - css.gg Icons - CgSpinnerAlt - SVG | WEBP | PNG | JPG - Icon free download
CgSpinnerAlt
spinner, loading, progress, waiting, loader, dual spinner, two-part loader, async indicator, pending, activity, refresh, ui feedback, status icon, motion, minimal loader, transition - css.gg Icons - CgSpinnerTwoAlt - SVG | WEBP | PNG | JPG - Icon free download
CgSpinnerTwoAlt
spinner, spinner two, loader, loading, progress, wait, buffering, activity, loop, rotation, reload, refresh, indicator, async, processing, status icon, ui spinner, modern ui, minimal loader, css gg - css.gg Icons - CgSpinnerTwo - SVG | WEBP | PNG | JPG - Icon free download
CgSpinnerTwo
spinner, loader, loading, progress, busy, refresh, cycle, rotate, waiting, indicator, processing, real time, ui spinner, minimal loader, clean ui, async, activity, css gg - css.gg Icons - CgSpinner - SVG | WEBP | PNG | JPG - Icon free download
CgSpinner
stories, story, media, social story, highlight, timeline, content, reels, shorts, status update, photo story, video story, feed, carousel, social ui, css gg - css.gg Icons - CgStories - SVG | WEBP | PNG | JPG - Icon free download
CgStories
tab, browser tab, ui tab, page tab, section, navigation, switch view, panel, layout, window, multitask, header, toolbar, menu, content switch, interaction - css.gg Icons - CgTab - SVG | WEBP | PNG | JPG - Icon free download
CgTab
tally, count, marks, score, measurement, tracking, stats, record, data, counting lines, notes, list, log, analytics, math, ui counter, evaluation - css.gg Icons - CgTally - SVG | WEBP | PNG | JPG - Icon free download
CgTally
terrain, landscape, topography, map, geography, mountains, hills, elevation, outdoor, environment, nature, hiking, navigation, map layers, geo data, earth surface - css.gg Icons - CgTerrain - SVG | WEBP | PNG | JPG - Icon free download
CgTerrain
tikcode, tiktok, qr, code, scan, profile code, social media, username code, shortcode, share, connect, follow, social identity, qr badge, profile link, scanner - css.gg Icons - CgTikcode - SVG | WEBP | PNG | JPG - Icon free download
CgTikcode
time, clock, hour, timer, schedule, duration, countdown, moment, alarm, reminder, timeline, clock face, time tracking, productivity, work timer, hours, time indicator - css.gg Icons - CgTime - SVG | WEBP | PNG | JPG - Icon free download
CgTime
timelapse, time, progress, speed, fast forward, interval, camera, photography, video, recording, motion, timeline, animation, effect, time flow, visual effect, media tool - css.gg Icons - CgTimelapse - SVG | WEBP | PNG | JPG - Icon free download
CgTimelapse
today, calendar, date, current day, schedule, planner, agenda, day view, events, reminder, task list, daily plan, timeline, appointment, ui element, navigation, minimal icon, outline style - css.gg Icons - CgToday - SVG | WEBP | PNG | JPG - Icon free download
CgToday
touchpad, trackpad, laptop input, gesture, pointer, cursor control, device input, hardware, ui navigation, scroll, tap, swipe, touch control, mouse alternative, input device, accessibility input, mobile gesture, track surface, navigation, movement control - css.gg Icons - CgTouchpad - SVG | WEBP | PNG | JPG - Icon free download
CgTouchpad
track, tracking, follow, monitor, path, route, navigation, delivery status, shipment, progress, timeline, transport, gps track, location path, logistics, route progress, map planning, status flow, journey, movement tracking, workflow track, progress route - css.gg Icons - CgTrack - SVG | WEBP | PNG | JPG - Icon free download
CgTrack
tv, television, screen, display, monitor, video, stream, broadcast, media, entertainment, show, movie, series, watch, smart tv, home theater, device, program, display unit, electronics, output device - css.gg Icons - CgTv - SVG | WEBP | PNG | JPG - Icon free download
CgTv
twitter, brand, social, tweet, bird, microblog, social network, post, share, communication, x platform, follow, engagement, viral, social media, profile, feed, timeline, hashtags, community, marketing, promotion - css.gg Icons - CgTwitter - SVG | WEBP | PNG | JPG - Icon free download
CgTwitter
undo, reverse, back, step back, rollback, history, edit, action, revert, restore, previous, command, toolbar, shortcut, correction, mistake, design tools, workflow, ui action, interaction, navigation - css.gg Icons - CgUndo - SVG | WEBP | PNG | JPG - Icon free download
CgUndo
unfold, expand, open, toggle, dropdown, accordion, layout expand, ui control, panel open, menu expand, navigation, interaction, button, hover action, sidebar toggle, ios, android, web app, responsive ui - css.gg Icons - CgUnfold - SVG | WEBP | PNG | JPG - Icon free download
CgUnfold
userlane, flow, journey, user path, workflow, process, steps, guided tour, onboarding, analytics, interaction flow, ux path, sequence, customer journey - css.gg Icons - CgUserlane - SVG | WEBP | PNG | JPG - Icon free download
CgUserlane
view day, day view, calendar, schedule, agenda, daily layout, planner, events, time management, timeline, ui view, organizer, appointment, day mode, date view, productivity tools - css.gg Icons - CgViewDay - SVG | WEBP | PNG | JPG - Icon free download
CgViewDay
airport, sign, airport sign, terminal, flight, navigation, travel, direction, wayfinding, location, map, guide, boarding, airplane, public transport, transport, navigation ui, ios, android, web app, header, footer, sidebar, menu icon, info sign, travel board, airport navigation, air travel - Circum Icons - CiAirportSign1 - SVG | WEBP | PNG | JPG - Icon free download
CiAirportSign1
barcode, scan, product code, inventory, retail, store, price, label, sku, tracking, logistics, warehouse, scanner, checkout, ecommerce, stock, qr alternative, code tag, product id, data - Circum Icons - CiBarcode - SVG | WEBP | PNG | JPG - Icon free download
CiBarcode
barcode, scan, product code, inventory, retail, store, price, label, sku, tracking, logistics, warehouse, scanner, checkout, ecommerce, stock, qr alternative, code tag, product id, data - Circum Icons - CiBarcode - SVG | WEBP | PNG | JPG - Icon free download
CiBarcode
box list, list, boxes, inventory, items, packages, storage, organization, warehouse, logistics, delivery, supply chain, ecommerce, catalog, collection, ui list, menu, stacked items - Circum Icons - CiBoxList - SVG | WEBP | PNG | JPG - Icon free download
CiBoxList
boxes, box, package, packages, parcel, shipment, cargo, storage, warehouse, stack, inventory, logistics, supply chain, ecommerce, delivery, packing, moving, container - Circum Icons - CiBoxes - SVG | WEBP | PNG | JPG - Icon free download
CiBoxes
brightness down, brightness, dim, lower brightness, display, screen, monitor, device control, settings, adjust, sun icon, light, dark mode, ui control, toolbar, quick settings, accessibility - Circum Icons - CiBrightnessDown - SVG | WEBP | PNG | JPG - Icon free download
CiBrightnessDown
brightness up, brightness, increase brightness, display, screen, monitor, light, sun, adjust, settings, ui control, toolbar, accessibility, system toggle, quick actions - Circum Icons - CiBrightnessUp - SVG | WEBP | PNG | JPG - Icon free download
CiBrightnessUp
calendar date, calendar, date, event, schedule, time, appointment, deadline, planner, task, meeting, booking, reminder, organize, timeline, day view, monthly view, ui calendar, datepicker, form input, agenda - Circum Icons - CiCalendarDate - SVG | WEBP | PNG | JPG - Icon free download
CiCalendarDate
calendar, date, schedule, event, planner, time management, appointment, monthly calendar, yearly calendar, timeline, reminder, task, booking, agenda, ui calendar, datepicker, calendar icon, management, organize, work planning - Circum Icons - CiCalendar - SVG | WEBP | PNG | JPG - Icon free download
CiCalendar
circle chevron down, chevron down, arrow down, expand, dropdown, open menu, collapse, scroll down, navigation, direction, ui control, accordion trigger, select field, minimal arrow, ios, android, web interface - Circum Icons - CiCircleChevDown - SVG | WEBP | PNG | JPG - Icon free download
CiCircleChevDown
compass, navigation, direction, north, map, travel, explore, gps, orientation, location, guide, pathfinding, adventure, route, journey, wayfinding, outdoor, hiking, tourism - Circum Icons - CiCompass1 - SVG | WEBP | PNG | JPG - Icon free download
CiCompass1
delivery truck, truck, shipping, delivery, logistics, transport, freight, courier, vehicle, express, fast delivery, order, package, ecommerce, tracking, fulfillment, supply chain, cargo, movement, service, transportation - Circum Icons - CiDeliveryTruck - SVG | WEBP | PNG | JPG - Icon free download
CiDeliveryTruck
mouse, desktop mouse, computer mouse, peripheral, pointer, cursor, input device, click, hardware, pc, workstation, office, controller, navigation, ui interaction, ios, android, desktop ui, ergonomics, gadget - Circum Icons - CiDesktopMouse1 - SVG | WEBP | PNG | JPG - Icon free download
CiDesktopMouse1
mouse, desktop mouse, computer mouse, input device, pointer, cursor, pc hardware, controller, navigation, ergonomic mouse, button, click, scroll, interaction, desktop ui, gadget, device settings - Circum Icons - CiDesktopMouse2 - SVG | WEBP | PNG | JPG - Icon free download
CiDesktopMouse2
desktop, computer, monitor, screen, display, pc, workstation, device, hardware, ui, window, os, browser, coding, design, dashboard, frontend, backend, work, office, productivity, tech - Circum Icons - CiDesktop - SVG | WEBP | PNG | JPG - Icon free download
CiDesktop
globe, world, global, earth, planet, international, navigation, map, geography, travel, location, global network, global access, internet, worldwide, global settings, web, network, header icon, footer icon, sidebar icon, ios, android, material, fluent, ui map, global search, discover, explore, continents, world map, sphere - Circum Icons - CiGlobe - SVG | WEBP | PNG | JPG - Icon free download
CiGlobe
gps, location, pin, marker, geolocation, tracking, detect location, navigate, find, map point, route, path, direction, travel, destination, ios, android, material ui, satellite, coordinate, compass, wayfinding, position, location services, map tool, geo search, navigation ui, sidebar navigation, mobile location - Circum Icons - CiGps - SVG | WEBP | PNG | JPG - Icon free download
CiGps
home, house, homepage, dashboard, start, main menu, navigation, real estate, property, landing, ui home, line house, minimal home, app home, root page, header icon, toolbar icon, clean outline - Circum Icons - CiHome - SVG | WEBP | PNG | JPG - Icon free download
CiHome
location arrow, pointer, direction, navigation, gps, map marker, arrow, compass, routing, travel, geolocation, wayfinding, navigate, tracking, move, target, cursor, explore, position, orientation - Circum Icons - CiLocationArrow1 - SVG | WEBP | PNG | JPG - Icon free download
CiLocationArrow1
location off, disabled location, gps off, map off, geolocation, tracking off, pin off, marker off, privacy, no access, restrict, deny, navigation, map control, ui toggle, sidebar, mobile ui, ios, android, web app, toolbar, header, footer, settings - Circum Icons - CiLocationOff - SVG | WEBP | PNG | JPG - Icon free download
CiLocationOff
location on, gps, geolocation, map pin, marker, tracking, position, route, navigation, map tool, destination, waypoint, mobile ui, android, ios, sidebar, toolbar, header, footer, live location, find me, locator - Circum Icons - CiLocationOn - SVG | WEBP | PNG | JPG - Icon free download
CiLocationOn
map pin, pin, marker, location, place, gps, geolocation, waypoint, destination, map marker, address, spot, navigation, travel, route, ui map, android, ios, mobile ui, web app - Circum Icons - CiMapPin - SVG | WEBP | PNG | JPG - Icon free download
CiMapPin
map, navigation, travel map, route, directions, gps, geolocation, terrain, atlas, area, location, map view, ui map, android, ios, mobile app, city map, tourism, delivery tracking, planner - Circum Icons - CiMap - SVG | WEBP | PNG | JPG - Icon free download
CiMap
menu, burger menu, hamburger, navigation, sidebar toggle, app menu, mobile nav, drawer, ui control, menu button, three lines, navigation icon, interface, expand menu, collapsed menu - Circum Icons - CiMenuBurger - SVG | WEBP | PNG | JPG - Icon free download
CiMenuBurger
menu fries, navigation, fries menu, vertical menu, three dots menu, list, options, more menu, ui control, overflow menu, settings menu, context menu, toolbar item, mobile menu - Circum Icons - CiMenuFries - SVG | WEBP | PNG | JPG - Icon free download
CiMenuFries
menu kebab, kebab menu, three dots, more options, overflow, context menu, vertical menu, settings, actions, ui control, navigation, toolbar action, popup menu, interactive menu - Circum Icons - CiMenuKebab - SVG | WEBP | PNG | JPG - Icon free download
CiMenuKebab
menu, burger menu, hamburger, navigation, sidebar toggle, app menu, mobile nav, drawer, ui control, menu button, three lines, navigation icon, interface, expand menu, collapsed menu - Circum Icons - CiMenuBurger - SVG | WEBP | PNG | JPG - Icon free download
CiMenuBurger
menu fries, navigation, fries menu, vertical menu, three dots menu, list, options, more menu, ui control, overflow menu, settings menu, context menu, toolbar item, mobile menu - Circum Icons - CiMenuFries - SVG | WEBP | PNG | JPG - Icon free download
CiMenuFries
menu kebab, kebab menu, three dots, more options, overflow, context menu, vertical menu, settings, actions, ui control, navigation, toolbar action, popup menu, interactive menu - Circum Icons - CiMenuKebab - SVG | WEBP | PNG | JPG - Icon free download
CiMenuKebab
monitor, screen, display, desktop, computer, pc, workstation, tech, device, ui layout, web design, coding, editor, dashboard, analytics screen, presentation, workspace, hardware, resolution, flat screen, lcd, interface, window, browser, view - Circum Icons - CiMonitor - SVG | WEBP | PNG | JPG - Icon free download
CiMonitor
music note, note, music, audio, sound, melody, song, track, playlist, tune, music player, mp3, media, soundtrack, instrument, beat, rhythm, entertainment, listen, audio control, music app - Circum Icons - CiMusicNote1 - SVG | WEBP | PNG | JPG - Icon free download
CiMusicNote1
no waiting, no wait, restriction, prohibited, warning, sign, traffic, regulation, alert, forbidden, rule, stop, zone, transport, public area, time restriction, queue, ban, notice, safety - Circum Icons - CiNoWaitingSign - SVG | WEBP | PNG | JPG - Icon free download
CiNoWaitingSign
parking, parking sign, car park, vehicle, transport, parking area, parking lot, p sign, urban, city, traffic, location, maps, garage, automobile, driver, spot, zone, navigation, public parking - Circum Icons - CiParking1 - SVG | WEBP | PNG | JPG - Icon free download
CiParking1
monitor, screen, display, desktop, computer, pc, workstation, tech, device, ui layout, web design, coding, editor, dashboard, analytics screen, presentation, workspace, hardware, resolution, flat screen, lcd, interface, window, browser, view - Circum Icons - CiMonitor - SVG | WEBP | PNG | JPG - Icon free download
CiMonitor
music note, note, music, audio, sound, melody, song, track, playlist, tune, music player, mp3, media, soundtrack, instrument, beat, rhythm, entertainment, listen, audio control, music app - Circum Icons - CiMusicNote1 - SVG | WEBP | PNG | JPG - Icon free download
CiMusicNote1
no waiting, no wait, restriction, prohibited, warning, sign, traffic, regulation, alert, forbidden, rule, stop, zone, transport, public area, time restriction, queue, ban, notice, safety - Circum Icons - CiNoWaitingSign - SVG | WEBP | PNG | JPG - Icon free download
CiNoWaitingSign
parking, parking sign, car park, vehicle, transport, parking area, parking lot, p sign, urban, city, traffic, location, maps, garage, automobile, driver, spot, zone, navigation, public parking - Circum Icons - CiParking1 - SVG | WEBP | PNG | JPG - Icon free download
CiParking1
plane, airplane, flight, travel, air travel, jet, airline, airport, map, destination, trip, vacation, tourism, logistics, shipping, cargo flight, international, booking, ticket, schedule, navigation, route, transport, travel icon, flight symbol, header icon, dashboard - Circum Icons - CiPlane - SVG | WEBP | PNG | JPG - Icon free download
CiPlane
suitcase, rolling suitcase, luggage, baggage, travel, trip, vacation, tourism, airport, carry on, bag, trolley, roller bag, hotel, hospitality, traveler, tourist gear, packing, transport, travel icon, luggage icon - Circum Icons - CiRollingSuitcase - SVG | WEBP | PNG | JPG - Icon free download
CiRollingSuitcase
route, path, direction, navigation, map route, travel path, planner, waypoint, journey, itinerary, gps, map line, navigation ui, trajectory, line map, route planning, workflow path, process flow, sidebar action, toolbar - Circum Icons - CiRoute - SVG | WEBP | PNG | JPG - Icon free download
CiRoute
satellite, space, gps, signal, transmission, broadcast, communication, orbit, antenna, navigation, tracking, telecom, remote sensing, geo, satcom, network coverage, global mapping, science tech, space device - Circum Icons - CiSatellite1 - SVG | WEBP | PNG | JPG - Icon free download
CiSatellite1
signpost, direction, duo sign, road sign, left right, navigation, maps, travel, guidance, path, route, wayfinding, location marker, tourist, outdoor, street sign, pointer, arrow board, navigation ui, material, ios, android, fluent, map interface - Circum Icons - CiSignpostDuo1 - SVG | WEBP | PNG | JPG - Icon free download
CiSignpostDuo1
signpost, left direction, left arrow, directional sign, guidepost, navigation, turn left, road sign, map marker, wayfinding, interface, ui icon, sidebar, menu, pathfinding, travel, route, pointer, arrow left, street sign - Circum Icons - CiSignpostL1 - SVG | WEBP | PNG | JPG - Icon free download
CiSignpostL1
signpost, right direction, right arrow, directional sign, guidepost, navigation, turn right, road sign, map marker, wayfinding, interface, ui icon, sidebar, menu, pathfinding, route, pointer, arrow right, street sign - Circum Icons - CiSignpostR1 - SVG | WEBP | PNG | JPG - Icon free download
CiSignpostR1
slider, horizontal slider, control bar, adjust, range input, seek bar, volume control, media control, settings, ui element, toolbar, controller, form input, progress, timeline, scrubber, user control - Circum Icons - CiSliderHorizontal - SVG | WEBP | PNG | JPG - Icon free download
CiSliderHorizontal
slider, vertical slider, control bar, adjust, range input, volume control, sound level, settings, ui component, toolbar, controller, scrubber, progress, timeline, user control - Circum Icons - CiSliderVertical - SVG | WEBP | PNG | JPG - Icon free download
CiSliderVertical
chevron down, arrow down, dropdown, expand, collapse, square chevron, down indicator, menu control, ui element, toolbar, navigation, scroll down, toggle, accordion control, direction - Circum Icons - CiSquareChevDown - SVG | WEBP | PNG | JPG - Icon free download
CiSquareChevDown
chevron left, arrow left, back, previous, square chevron, navigation, ui element, scroll left, toggle, sidebar, menu control, pagination, direction, left control - Circum Icons - CiSquareChevLeft - SVG | WEBP | PNG | JPG - Icon free download
CiSquareChevLeft
chevron right, arrow right, forward, next, square chevron, navigation, ui element, scroll right, toggle, sidebar, menu control, pagination, direction, right control - Circum Icons - CiSquareChevRight - SVG | WEBP | PNG | JPG - Icon free download
CiSquareChevRight
stop sign, stop, traffic sign, warning sign, danger, halt, octagon, road symbol, safety icon, caution, alert, transport, map ui, navigation, road warning, traffic control, ios, android, outline icon, material style - Circum Icons - CiStopSign1 - SVG | WEBP | PNG | JPG - Icon free download
CiStopSign1
turn left, left turn, arrow left, direction, navigation, route, map, gps, driving, transport, travel, wayfinding, left arrow, turn signal, path, street navigation, map tool, ui arrow, routing control - Circum Icons - CiTurnL1 - SVG | WEBP | PNG | JPG - Icon free download
CiTurnL1
turn right, right turn, arrow right, direction, navigation, route, map, gps, driving, transport, travel, wayfinding, right arrow, turn signal, path, street navigation, map tool, ui arrow, routing control - Circum Icons - CiTurnR1 - SVG | WEBP | PNG | JPG - Icon free download
CiTurnR1
twitter, brand, social media, tweet, x, microblog, share, communication, community, network, promotion, marketing, social platform, social network, social icon, post, follow, profile, hashtag, timeline - Circum Icons - CiTwitter - SVG | WEBP | PNG | JPG - Icon free download
CiTwitter
undo, reverse, back, revert, restore, history, previous, step back, action, toolbar, button, editor, document edit, navigation, ios, android, material style, rollback, cancel change, arrow, command - Circum Icons - CiUndo - SVG | WEBP | PNG | JPG - Icon free download
CiUndo
view timeline, timeline, progress, milestones, history, chronology, workflow, project timeline, events, task progression, gantt-like, planning, roadmap, schedule, sequence, time flow, ui component, storyline, tracking - Circum Icons - CiViewTimeline - SVG | WEBP | PNG | JPG - Icon free download
CiViewTimeline
wave, pulse, waveform, signal, audio, heartbeat, monitor, sensor, oscillation, visualizer, equalizer, spectrum, real-time, live data, streaming, analytics, dashboard, health tracker, iot sensor, media player, sound, voice, widget, control, animation, status, indicator, inspect, measure, visual - Circum Icons - CiWavePulse1 - SVG | WEBP | PNG | JPG - Icon free download
CiWavePulse1
zoom, zoom out, minimize, reduce, magnifier, search, fit to screen, overview, map control, image viewer, decrease size, accessibility, toolbar, modal, gallery, navigation, reader, ui control, button, icon, symbol, viewer, header, sidebar, interactive, zoom control - Circum Icons - CiZoomOut - SVG | WEBP | PNG | JPG - Icon free download
CiZoomOut
compass, navigation, direction, tool, map, guide, orientation, devtools, workflow, web dev, ui icon, sidebar, menu, button, tooling, design system, reference, utility icon, framework, coding, layout, grid - Devicons - DiCompass - SVG | WEBP | PNG | JPG - Icon free download
DiCompass
google analytics, ga, analytics, tracking, metrics, data, dashboard, charts, conversion, traffic, events, behavior, funnels, audience, web analytics, measurement, performance, reports, marketing, seo, ppc, insights, optimisation, tracking code, tag manager, platform, brand - Devicons - DiGoogleAnalytics - SVG | WEBP | PNG | JPG - Icon free download
DiGoogleAnalytics
hackernews, hn, news, tech news, developer news, programming news, community, blog, discussion, feed, aggregator, open source, brand, logo, social platform, tech community, sidebar link, header link, navigation - Devicons - DiHackernews - SVG | WEBP | PNG | JPG - Icon free download
DiHackernews
opera, browser, web browser, internet, navigation, web access, tabs, search, ui, mobile browser, desktop browser, software, developer tools, testing, cross browser, compatibility, performance, network, branding, logo - Devicons - DiOpera - SVG | WEBP | PNG | JPG - Icon free download
DiOpera
safari, safari browser, apple browser, web browser, macos, ios, explorer, navigation, internet, web app, ui, ux, mobile, desktop, cross platform, web navigation, browser icon, bookmark, tab, brand - Devicons - DiSafari - SVG | WEBP | PNG | JPG - Icon free download
DiSafari
techcrunch, brand, logo, news site, tech media, startup news, technology blog, magazine, press, publication, editorial, website logo, media brand, news platform, tech journalism, header logo, footer logo, sidebar logo, navigation, brand icon - Devicons - DiTechcrunch - SVG | WEBP | PNG | JPG - Icon free download
DiTechcrunch
adn, app dot net, social network, microblogging, communication, brand, logo, messaging, timeline, community, developer platform, api, social media, tech - Font Awesome 5 - FaAdn - SVG | WEBP | PNG | JPG - Icon free download
FaAdn
avianex, airline, flight, air travel, aviation, booking, airport, travel, transportation, brand, logo, ticketing, journey, trip, flight service, badge, button - Font Awesome 5 - FaAvianex - SVG | WEBP | PNG | JPG - Icon free download
FaAvianex
Tags
navigationuitransportdirectionmaptoolbarfilledarrowtraveloutlinemediabuttonaudioroutevehiclevideopointermonitorroadiossidebarsigntrafficandroidtimelinemenuplayercontroltracklocationdashboardwarninggpsschedulepaneltrackingdevicepathleftlayoutuxplannerintersectionmusictogglecalendarscreenpreviousnextprogressskipplaybackweblogisticsrighthardwarewayfindingdisplayforwardcursordownheaderplaylistdesktopcirclecarcomputersoundstopindicatordatedeliverydropdownrewindui controlbackscrolleventwindowguidestreetagendashippingpccollapsemoveuptimeeditoralertinteractionbookingcargoloadingsafetyhometurncontrolssongbrandexplorejourneycaretfilebackwardentertainmentcornerreminderrideexpandclickfronticonanalyticsfooteractionworkflowappointmentboxclockviewinterfacecommutetraintripmobileprohibitedmarker