CRUDIOS
travis, travis ci, brand, logo, ci, cd, continuous integration, continuous delivery, pipeline, automation, build, test, deploy, devops, developer tools, workflow, infrastructure, service logo, cloud workflow, github actions alternative - Devicons - DiTravis - SVG | WEBP | PNG | JPG - Icon free download
di/DiTravis

di/DiTravis (Devicons)

VS Code
1import { DiTravis } from "react-icons/di";
2
3export default function Page(){
4  return <div><DiTravis/></div>
5}
Click To Copy (Free To Use)
Description
Brand icon for Travis CI, representing continuous integration and automated deployment workflows, suitable for devops dashboards, build pipelines, testing systems, status indicators, and software engineering tool interfaces.
Tags
travistravis cibrandlogocicdcontinuous integrationcontinuous deliverypipelineautomationbuildtestdeploydevopsdeveloper toolsworkflowinfrastructureservice logocloud workflowgithub actions alternative
Categories
developmentdevopscicdautomationtoolscloudinfrastructuretestingbuild systemsbranding
WEBP Download (256px)Customize & Download (HD)
Related Icons
alipay, payment, wallet, finance, brand, transaction, china - Ant Design Icons - AiFillAlipayCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillAlipayCircle
alipay, square, brand, wallet, payment, china, logo - Ant Design Icons - AiFillAlipaySquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillAlipaySquare
aliwangwang, chat, im, messaging, brand, alibaba - Ant Design Icons - AiFillAliwangwang - SVG | WEBP | PNG | JPG - Icon free download
AiFillAliwangwang
amazon, circle, brand, store, ecommerce, logo, retail - Ant Design Icons - AiFillAmazonCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillAmazonCircle
amazon, square, brand, store, ecommerce, retail, logo - Ant Design Icons - AiFillAmazonSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillAmazonSquare
android, robot, os, mobile, brand, google, logo - Ant Design Icons - AiFillAndroid - SVG | WEBP | PNG | JPG - Icon free download
AiFillAndroid
apple, brand, ios, mac, logo, technology, store - Ant Design Icons - AiFillApple - SVG | WEBP | PNG | JPG - Icon free download
AiFillApple
appstore, apps, store, download, apple, mobile, brand - Ant Design Icons - AiFillAppstore - SVG | WEBP | PNG | JPG - Icon free download
AiFillAppstore
behance, brand, circle, logo, social, design, portfolio - Ant Design Icons - AiFillBehanceCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillBehanceCircle
behance, brand, square, logo, design, portfolio, social - Ant Design Icons - AiFillBehanceSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillBehanceSquare
bilibili, brand, logo, video, anime, streaming, social - Ant Design Icons - AiFillBilibili - SVG | WEBP | PNG | JPG - Icon free download
AiFillBilibili
build, tools, wrench, settings, configure, maintenance - Ant Design Icons - AiFillBuild - SVG | WEBP | PNG | JPG - Icon free download
AiFillBuild
chrome, browser, google, web, brand, logo, internet - Ant Design Icons - AiFillChrome - SVG | WEBP | PNG | JPG - Icon free download
AiFillChrome
ci, circle, symbol, mark, label, identifier - Ant Design Icons - AiFillCiCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillCiCircle
codesandbox, circle, sandbox, code, dev, tool, brand - Ant Design Icons - AiFillCodeSandboxCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillCodeSandboxCircle
codesandbox, square, sandbox, code, dev, tool, brand - Ant Design Icons - AiFillCodeSandboxSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillCodeSandboxSquare
codepen, circle, pen, dev, tool, brand, editor - Ant Design Icons - AiFillCodepenCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillCodepenCircle
codepen, square, pen, dev, tool, brand, editor - Ant Design Icons - AiFillCodepenSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillCodepenSquare
dingtalk, brand, chat, messaging, circle, social, work - Ant Design Icons - AiFillDingtalkCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillDingtalkCircle
dingtalk, brand, chat, messaging, square, social, work - Ant Design Icons - AiFillDingtalkSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillDingtalkSquare
discord, brand, chat, gaming, community, social, voice - Ant Design Icons - AiFillDiscord - SVG | WEBP | PNG | JPG - Icon free download
AiFillDiscord
dribbble, brand, design, circle, community, portfolio, social - Ant Design Icons - AiFillDribbbleCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillDribbbleCircle
dribbble, brand, design, square, community, portfolio, social - Ant Design Icons - AiFillDribbbleSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillDribbbleSquare
dropbox, brand, cloud, storage, circle, files, sync - Ant Design Icons - AiFillDropboxCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillDropboxCircle
dropbox, brand, cloud, storage, square, files, sync - Ant Design Icons - AiFillDropboxSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillDropboxSquare
experiment, lab, test, flask, science, research - Ant Design Icons - AiFillExperiment - SVG | WEBP | PNG | JPG - Icon free download
AiFillExperiment
facebook, social, brand, network, share, media - Ant Design Icons - AiFillFacebook - SVG | WEBP | PNG | JPG - Icon free download
AiFillFacebook
github, brand, code, repo, developer, version-control - Ant Design Icons - AiFillGithub - SVG | WEBP | PNG | JPG - Icon free download
AiFillGithub
gitlab, brand, code, ci, repo, developer - Ant Design Icons - AiFillGitlab - SVG | WEBP | PNG | JPG - Icon free download
AiFillGitlab
google, brand, circle, logo, search, google-icon - Ant Design Icons - AiFillGoogleCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillGoogleCircle
google, google-plus, brand, circle, logo, social - Ant Design Icons - AiFillGooglePlusCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillGooglePlusCircle
google, google-plus, brand, square, logo, social - Ant Design Icons - AiFillGooglePlusSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillGooglePlusSquare
google, square, brand, logo, search, google-icon - Ant Design Icons - AiFillGoogleSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillGoogleSquare
instagram, social, photo, media, social-network, brand - Ant Design Icons - AiFillInstagram - SVG | WEBP | PNG | JPG - Icon free download
AiFillInstagram
linkedin, social, professional, network, brand, profile - Ant Design Icons - AiFillLinkedin - SVG | WEBP | PNG | JPG - Icon free download
AiFillLinkedin
medium, blog, publishing, social, brand - Ant Design Icons - AiFillMediumCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillMediumCircle
medium, blog, publishing, social, brand - Ant Design Icons - AiFillMediumSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillMediumSquare
openai, ai, gpt, brand, chatbot - Ant Design Icons - AiFillOpenAI - SVG | WEBP | PNG | JPG - Icon free download
AiFillOpenAI
pinterest, social, pinboard, image, brand - Ant Design Icons - AiFillPinterest - SVG | WEBP | PNG | JPG - Icon free download
AiFillPinterest
qq, tencent, social, messenger, brand - Ant Design Icons - AiFillQqCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillQqCircle
qq, tencent, social, messenger, brand - Ant Design Icons - AiFillQqSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillQqSquare
reddit, logo, circle, brand, social, community, forum - Ant Design Icons - AiFillRedditCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillRedditCircle
reddit, logo, square, brand, social, community, forum - Ant Design Icons - AiFillRedditSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillRedditSquare
robot, bot, ai, automation, machine, assistant, tech - Ant Design Icons - AiFillRobot - SVG | WEBP | PNG | JPG - Icon free download
AiFillRobot
sketch, logo, brand, design, circle, tool, ui - Ant Design Icons - AiFillSketchCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillSketchCircle
sketch, logo, brand, design, square, tool, ui - Ant Design Icons - AiFillSketchSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillSketchSquare
skype, brand, call, chat, video, message, voip, social - Ant Design Icons - AiFillSkype - SVG | WEBP | PNG | JPG - Icon free download
AiFillSkype
slack, brand, chat, team, workspace, circle, message, collab - Ant Design Icons - AiFillSlackCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillSlackCircle
slack, brand, chat, team, workspace, square, message, collab - Ant Design Icons - AiFillSlackSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillSlackSquare
spotify, brand, music, audio, stream, playlist, social - Ant Design Icons - AiFillSpotify - SVG | WEBP | PNG | JPG - Icon free download
AiFillSpotify
taobao, brand, china, ecommerce, market, circle, store - Ant Design Icons - AiFillTaobaoCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillTaobaoCircle
taobao, square, marketplace, shopping, brand, logo - Ant Design Icons - AiFillTaobaoSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillTaobaoSquare
tiktok, music, video, social, brand, logo - Ant Design Icons - AiFillTikTok - SVG | WEBP | PNG | JPG - Icon free download
AiFillTikTok
trademark, tm, circle, brand, rights, legal - Ant Design Icons - AiFillTrademarkCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillTrademarkCircle
twitch, stream, gaming, video, brand, logo - Ant Design Icons - AiFillTwitch - SVG | WEBP | PNG | JPG - Icon free download
AiFillTwitch
twitter, circle, tweet, social, brand, logo - Ant Design Icons - AiFillTwitterCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillTwitterCircle
twitter, square, tweet, social, brand, logo - Ant Design Icons - AiFillTwitterSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillTwitterSquare
wechat, work, chat, message, brand, logo - Ant Design Icons - AiFillWechatWork - SVG | WEBP | PNG | JPG - Icon free download
AiFillWechatWork
wechat, chat, message, social, logo, brand - Ant Design Icons - AiFillWechat - SVG | WEBP | PNG | JPG - Icon free download
AiFillWechat
weibo, circle, social, logo, brand, microblog - Ant Design Icons - AiFillWeiboCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillWeiboCircle
weibo, square, social, logo, brand, microblog - Ant Design Icons - AiFillWeiboSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillWeiboSquare
windows, microsoft, os, logo, brand, system - Ant Design Icons - AiFillWindows - SVG | WEBP | PNG | JPG - Icon free download
AiFillWindows
x, twitter, logo, brand, social, microblog - Ant Design Icons - AiFillX - SVG | WEBP | PNG | JPG - Icon free download
AiFillX
yahoo, logo, brand, mail, portal, search - Ant Design Icons - AiFillYahoo - SVG | WEBP | PNG | JPG - Icon free download
AiFillYahoo
youtube, video, play, logo, brand, media - Ant Design Icons - AiFillYoutube - SVG | WEBP | PNG | JPG - Icon free download
AiFillYoutube
yuque, docs, wiki, logo, brand, knowledge - Ant Design Icons - AiFillYuque - SVG | WEBP | PNG | JPG - Icon free download
AiFillYuque
zhihu, circle, qa, logo, brand, knowledge - Ant Design Icons - AiFillZhihuCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillZhihuCircle
zhihu, square, qa, logo, brand, knowledge - Ant Design Icons - AiFillZhihuSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillZhihuSquare
alibaba, logo, brand, commerce, marketplace, outline - Ant Design Icons - AiOutlineAlibaba - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAlibaba
alipay, circle, payment, logo, brand, wallet - Ant Design Icons - AiOutlineAlipayCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAlipayCircle
alipay, logo, brand, payment, wallet, outline - Ant Design Icons - AiOutlineAlipay - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAlipay
aliwangwang, chat, message, brand, logo, outline - Ant Design Icons - AiOutlineAliwangwang - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAliwangwang
aliyun, cloud, compute, brand, logo, outline - Ant Design Icons - AiOutlineAliyun - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAliyun
amazon, logo, brand, store, commerce, outline - Ant Design Icons - AiOutlineAmazon - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAmazon
android, robot, logo, brand, mobile, outline - Ant Design Icons - AiOutlineAndroid - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAndroid
ant, design, antdesign, ui, logo, outline - Ant Design Icons - AiOutlineAntDesign - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAntDesign
apple, logo, brand, mac, ios, outline - Ant Design Icons - AiOutlineApple - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineApple
baidu, brand, logo, search, china, engine - Ant Design Icons - AiOutlineBaidu - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBaidu
behance, square, logo, design, portfolio, brand - Ant Design Icons - AiOutlineBehanceSquare - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBehanceSquare
behance, logo, design, portfolio, creative, brand - Ant Design Icons - AiOutlineBehance - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBehance
bilibili, logo, video, china, brand, anime - Ant Design Icons - AiOutlineBilibili - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBilibili
bug, error, issue, debug, problem, code, test - Ant Design Icons - AiOutlineBug - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBug
build, tool, wrench, settings, configure, maintenance, setup - Ant Design Icons - AiOutlineBuild - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBuild
chrome, google, browser, web, internet, brand, navigation - Ant Design Icons - AiOutlineChrome - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineChrome
ci, currency, circle, money, cash, payment, symbol - Ant Design Icons - AiOutlineCiCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCiCircle
ci, currency, symbol, mark, letter, interface - Ant Design Icons - AiOutlineCi - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCi
cloud, server, hosting, backend, storage, network, infrastructure - Ant Design Icons - AiOutlineCloudServer - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCloudServer
codesandbox, sandbox, dev, code, tool, editor, brand - Ant Design Icons - AiOutlineCodeSandbox - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCodeSandbox
codepen, circle, pen, editor, dev, brand, playground - Ant Design Icons - AiOutlineCodepenCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCodepenCircle
codepen, pen, editor, dev, frontend, brand, playground - Ant Design Icons - AiOutlineCodepen - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCodepen
deployment, unit, network, nodes, devops, cluster, structure - Ant Design Icons - AiOutlineDeploymentUnit - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDeploymentUnit
dingding, brand, chat, communication, message, im, enterprise - Ant Design Icons - AiOutlineDingding - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDingding
dingtalk, brand, chat, communication, message, im, enterprise - Ant Design Icons - AiOutlineDingtalk - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDingtalk
discord, brand, chat, server, gaming, community, message - Ant Design Icons - AiOutlineDiscord - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDiscord
docker, containers, devops, platform, cloud, deployment - Ant Design Icons - AiOutlineDocker - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDocker
dribbble, square, brand, design, community, social - Ant Design Icons - AiOutlineDribbbleSquare - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDribbbleSquare
dribbble, brand, design, community, ball, social - Ant Design Icons - AiOutlineDribbble - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDribbble
dropbox, cloud, storage, file, sync, brand - Ant Design Icons - AiOutlineDropbox - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDropbox
experiment, lab, test, flask, chemistry, science, research - Ant Design Icons - AiOutlineExperiment - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineExperiment
facebook, social, meta, share, network, brand, community - Ant Design Icons - AiOutlineFacebook - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFacebook
github, brand, code, repository, developer, version-control - Ant Design Icons - AiOutlineGithub - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineGithub
gitlab, brand, ci, cd, repository, devops, code - Ant Design Icons - AiOutlineGitlab - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineGitlab
google-plus, google, brand, social, share, platform - Ant Design Icons - AiOutlineGooglePlus - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineGooglePlus
google, brand, search, engine, web, platform - Ant Design Icons - AiOutlineGoogle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineGoogle
harmonyos, os, huawei, system, brand, software, platform - Ant Design Icons - AiOutlineHarmonyOS - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineHarmonyOS
html5, web, code, markup, frontend, brand, developer - Ant Design Icons - AiOutlineHtml5 - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineHtml5
ie, internet-explorer, browser, microsoft, legacy, web, brand - Ant Design Icons - AiOutlineIe - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineIe
instagram, social, photo, media, brand, share, camera - Ant Design Icons - AiOutlineInstagram - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineInstagram
javascript, js, code, programming, script, developer, brand - Ant Design Icons - AiOutlineJavaScript - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineJavaScript
java, code, programming, developer, language, brand - Ant Design Icons - AiOutlineJava - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineJava
kubernetes, k8s, containers, devops, orchestration, brand - Ant Design Icons - AiOutlineKubernetes - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineKubernetes
linkedin, social, network, profile, business, brand, connect - Ant Design Icons - AiOutlineLinkedin - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLinkedin
linux, os, penguin, system, kernel, open-source, brand - Ant Design Icons - AiOutlineLinux - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLinux
medium, logo, brand, blog, writing, publish, social - Ant Design Icons - AiOutlineMediumWorkmark - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMediumWorkmark
medium, logo, brand, blog, writing, content, publish - Ant Design Icons - AiOutlineMedium - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMedium
openai, brand, ai, logo, machine-learning, ml, tool - Ant Design Icons - AiOutlineOpenAI - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineOpenAI
pinterest, social, brand, pin, share, network, media - Ant Design Icons - AiOutlinePinterest - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePinterest
reddit, social, community, forum, brand, chat - Ant Design Icons - AiOutlineReddit - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineReddit
robot, bot, automation, ai, machine, tech, assistant - Ant Design Icons - AiOutlineRobot - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineRobot
sketch, logo, brand, design, tool, vector - Ant Design Icons - AiOutlineSketch - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSketch
skype, call, video, chat, brand, voip - Ant Design Icons - AiOutlineSkype - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSkype
slack, square, chat, team, collaboration, brand - Ant Design Icons - AiOutlineSlackSquare - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSlackSquare
slack, chat, team, collaboration, brand, workspace - Ant Design Icons - AiOutlineSlack - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSlack
solution, plan, strategy, task, workflow, guide - Ant Design Icons - AiOutlineSolution - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSolution
spotify, music, audio, streaming, brand, playlist - Ant Design Icons - AiOutlineSpotify - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSpotify
taobao, circle, logo, china, shopping, ecommerce - Ant Design Icons - AiOutlineTaobaoCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTaobaoCircle
taobao, logo, china, shopping, marketplace, ecommerce - Ant Design Icons - AiOutlineTaobao - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTaobao
tiktok, logo, video, social media, short video, music - Ant Design Icons - AiOutlineTikTok - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTikTok
trademark, tm, brand, registered, intellectual property, legal - Ant Design Icons - AiOutlineTrademark - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTrademark
twitch, logo, streaming, gaming, live stream, video - Ant Design Icons - AiOutlineTwitch - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTwitch
twitter, x, logo, social media, tweet, bird - Ant Design Icons - AiOutlineTwitter - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTwitter
windows, microsoft, os, operating system, logo - Ant Design Icons - AiOutlineWindows - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineWindows
yahoo, logo, brand, email, search, portal - Ant Design Icons - AiOutlineYahoo - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineYahoo
youtube, video, logo, brand, streaming, play - Ant Design Icons - AiOutlineYoutube - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineYoutube
yuque, logo, knowledge, docs, notes, ant - Ant Design Icons - AiOutlineYuque - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineYuque
zhihu, logo, q&a, questions, answers, china - Ant Design Icons - AiOutlineZhihu - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineZhihu
build, tool, wrench, construction, settings, maintenance - Ant Design Icons - AiTwotoneBuild - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneBuild
ci, circle, copyright, symbol, trademark, finance, currency, info - Ant Design Icons - AiTwotoneCiCircle - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCiCircle
ci, corporate, identity, symbol, information, brand, finance, currency - Ant Design Icons - AiTwotoneCi - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCi
experiment, lab, test, flask, chemistry, science, research - Ant Design Icons - AiTwotoneExperiment - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneExperiment
html5, web, code, markup, frontend, brand - Ant Design Icons - AiTwotoneHtml5 - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneHtml5
trademark, tm, brand, legal, circle, mark - Ant Design Icons - AiTwotoneTrademarkCircle - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneTrademarkCircle
bot, robot, ai, automation, chatbot, assistant, machine - BoxIcons - BiBot - SVG | WEBP | PNG | JPG - Icon free download
BiBot
disc, cd, dvd, media, audio, storage - BoxIcons - BiDisc - SVG | WEBP | PNG | JPG - Icon free download
BiDisc
registered, r, trademark, legal, brand, protection, symbol - BoxIcons - BiRegistered - SVG | WEBP | PNG | JPG - Icon free download
BiRegistered
server, hosting, database, backend, rack, system, infrastructure - BoxIcons - BiServer - SVG | WEBP | PNG | JPG - Icon free download
BiServer
test, tube, lab, science, experiment, chemistry, sample - BoxIcons - BiTestTube - SVG | WEBP | PNG | JPG - Icon free download
BiTestTube
vial, tube, lab, sample, test, medicine, science, chemical - BoxIcons - BiVial - SVG | WEBP | PNG | JPG - Icon free download
BiVial
windows, microsoft, os, brand, system, software, desktop - BoxIcons - BiWindows - SVG | WEBP | PNG | JPG - Icon free download
BiWindows
bot, robot, ai, automation, assistant, chatbot, machine - BoxIcons - BiSolidBot - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBot
bug, error, issue, debug, problem, test, code - BoxIcons - BiSolidBugAlt - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBugAlt
bug, debug, issue, error, problem, test, code - BoxIcons - BiSolidBug - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBug
disc, cd, dvd, media, music, audio - BoxIcons - BiSolidDisc - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDisc
eject, media, remove, drive, cd, player, stop - BoxIcons - BiSolidEject - SVG | WEBP | PNG | JPG - Icon free download
BiSolidEject
registered, trademark, legal, symbol, brand, rights - BoxIcons - BiSolidRegistered - SVG | WEBP | PNG | JPG - Icon free download
BiSolidRegistered
server, database, hosting, backend, stack, infrastructure - BoxIcons - BiSolidServer - SVG | WEBP | PNG | JPG - Icon free download
BiSolidServer
vial, lab, test, sample, medicine, chemistry, tube, medical - BoxIcons - BiSolidVial - SVG | WEBP | PNG | JPG - Icon free download
BiSolidVial
500px, photography, photos, portfolio, brand, social - BoxIcons - BiLogo500Px - SVG | WEBP | PNG | JPG - Icon free download
BiLogo500Px
99designs, design, freelance, creative, brand, logo - BoxIcons - BiLogo99Designs - SVG | WEBP | PNG | JPG - Icon free download
BiLogo99Designs
adobe, creative, software, design, photoshop, brand - BoxIcons - BiLogoAdobe - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAdobe
airbnb, travel, stay, booking, rent, brand - BoxIcons - BiLogoAirbnb - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAirbnb
algolia, search, api, index, brand, developer - BoxIcons - BiLogoAlgolia - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAlgolia
amazon, shopping, ecommerce, store, brand, retail - BoxIcons - BiLogoAmazon - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAmazon
android, mobile, os, google, brand, robot - BoxIcons - BiLogoAndroid - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAndroid
angular, framework, frontend, web, brand, developer - BoxIcons - BiLogoAngular - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAngular
apple, ios, mac, brand, tech, device - BoxIcons - BiLogoApple - SVG | WEBP | PNG | JPG - Icon free download
BiLogoApple
audible, audio, books, podcast, brand, listen - BoxIcons - BiLogoAudible - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAudible
aws, amazon, cloud, server, hosting, brand - BoxIcons - BiLogoAws - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAws
baidu, search, china, engine, brand, web - BoxIcons - BiLogoBaidu - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBaidu
behance, design, portfolio, creative, brand, art - BoxIcons - BiLogoBehance - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBehance
bing, search, engine, microsoft, brand, web - BoxIcons - BiLogoBing - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBing
bitcoin, crypto, currency, btc, brand, payment - BoxIcons - BiLogoBitcoin - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBitcoin
blender, 3d, modeling, animation, render, design, brand - BoxIcons - BiLogoBlender - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBlender
blogger, blog, write, post, google, brand, content - BoxIcons - BiLogoBlogger - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBlogger
bootstrap, css, framework, ui, web, design, brand - BoxIcons - BiLogoBootstrap - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBootstrap
c++, cpp, programming, code, language, developer, brand - BoxIcons - BiLogoCPlusPlus - SVG | WEBP | PNG | JPG - Icon free download
BiLogoCPlusPlus
chrome, google, browser, web, internet, brand, navigate - BoxIcons - BiLogoChrome - SVG | WEBP | PNG | JPG - Icon free download
BiLogoChrome
codepen, code, snippet, frontend, developer, brand, share - BoxIcons - BiLogoCodepen - SVG | WEBP | PNG | JPG - Icon free download
BiLogoCodepen
creative, commons, cc, license, rights, brand, media - BoxIcons - BiLogoCreativeCommons - SVG | WEBP | PNG | JPG - Icon free download
BiLogoCreativeCommons
css, css3, style, web, design, frontend, brand - BoxIcons - BiLogoCss3 - SVG | WEBP | PNG | JPG - Icon free download
BiLogoCss3
dailymotion, video, media, stream, brand, watch, share - BoxIcons - BiLogoDailymotion - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDailymotion
deezer, music, audio, stream, brand, playlist, song - BoxIcons - BiLogoDeezer - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDeezer
devto, developer, blog, article, community, brand, tech - BoxIcons - BiLogoDevTo - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDevTo
deviantart, art, artist, gallery, design, brand, share - BoxIcons - BiLogoDeviantart - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDeviantart
digg, news, share, feed, social, brand, content - BoxIcons - BiLogoDigg - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDigg
digitalocean, cloud, hosting, server, deploy, brand, infrastructure - BoxIcons - BiLogoDigitalocean - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDigitalocean
discord, chat, server, community, gaming, brand, alt - BoxIcons - BiLogoDiscordAlt - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDiscordAlt
discord, chat, message, server, community, brand, gaming - BoxIcons - BiLogoDiscord - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDiscord
discourse, forum, discussion, community, threads, brand, chat - BoxIcons - BiLogoDiscourse - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDiscourse
django, python, framework, backend, web, developer, brand - BoxIcons - BiLogoDjango - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDjango
docker, container, devops, deploy, image, brand, infrastructure - BoxIcons - BiLogoDocker - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDocker
dribbble, design, shots, creative, portfolio, brand, share - BoxIcons - BiLogoDribbble - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDribbble
dropbox, storage, cloud, sync, files, brand, backup - BoxIcons - BiLogoDropbox - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDropbox
drupal, cms, website, content, developer, brand, platform - BoxIcons - BiLogoDrupal - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDrupal
ebay, marketplace, buy, sell, auction, brand, shop - BoxIcons - BiLogoEbay - SVG | WEBP | PNG | JPG - Icon free download
BiLogoEbay
edge, microsoft, browser, web, internet, brand, navigate - BoxIcons - BiLogoEdge - SVG | WEBP | PNG | JPG - Icon free download
BiLogoEdge
etsy, marketplace, store, crafts, seller, shop, logo - BoxIcons - BiLogoEtsy - SVG | WEBP | PNG | JPG - Icon free download
BiLogoEtsy
facebook, circle, social, media, share, profile, logo - BoxIcons - BiLogoFacebookCircle - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFacebookCircle
facebook, square, social, media, share, profile, logo - BoxIcons - BiLogoFacebookSquare - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFacebookSquare
facebook, social, media, share, profile, logo, community - BoxIcons - BiLogoFacebook - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFacebook
figma, design, ui, ux, prototype, tool, logo - BoxIcons - BiLogoFigma - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFigma
firebase, backend, cloud, database, hosting, google, logo - BoxIcons - BiLogoFirebase - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFirebase
firefox, browser, mozilla, web, internet, logo, search - BoxIcons - BiLogoFirefox - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFirefox
flask, python, framework, backend, web, api, logo - BoxIcons - BiLogoFlask - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFlask
flickr, square, photos, images, gallery, social, logo - BoxIcons - BiLogoFlickrSquare - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFlickrSquare
flickr, photos, images, gallery, share, social, logo - BoxIcons - BiLogoFlickr - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFlickr
flutter, mobile, app, ui, framework, google, logo - BoxIcons - BiLogoFlutter - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFlutter
foursquare, location, checkin, map, social, explore, logo - BoxIcons - BiLogoFoursquare - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFoursquare
git, version, control, repo, commit, developer, logo - BoxIcons - BiLogoGit - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGit
github, repo, code, version, developer, open source, logo - BoxIcons - BiLogoGithub - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGithub
gitlab, devops, repo, pipeline, ci, cd, logo - BoxIcons - BiLogoGitlab - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGitlab
gmail, email, mail, google, inbox, message, logo - BoxIcons - BiLogoGmail - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGmail
golang, go, language, backend, compiler, developer, logo - BoxIcons - BiLogoGoLang - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGoLang
google, cloud, gcp, hosting, compute, infrastructure, logo - BoxIcons - BiLogoGoogleCloud - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGoogleCloud
google, plus, circle, social, share, community, logo - BoxIcons - BiLogoGooglePlusCircle - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGooglePlusCircle
google, plus, social, media, share, community, logo - BoxIcons - BiLogoGooglePlus - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGooglePlus
google, search, engine, web, internet, logo, account - BoxIcons - BiLogoGoogle - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGoogle
graphql, api, schema, query, backend, developer, logo - BoxIcons - BiLogoGraphql - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGraphql
heroku, hosting, cloud, deploy, app, platform, logo - BoxIcons - BiLogoHeroku - SVG | WEBP | PNG | JPG - Icon free download
BiLogoHeroku
html5, markup, web, frontend, developer, code, logo - BoxIcons - BiLogoHtml5 - SVG | WEBP | PNG | JPG - Icon free download
BiLogoHtml5
imdb, movies, ratings, films, database, reviews, logo - BoxIcons - BiLogoImdb - SVG | WEBP | PNG | JPG - Icon free download
BiLogoImdb
instagram, alt, photo, share, stories, camera, logo - BoxIcons - BiLogoInstagramAlt - SVG | WEBP | PNG | JPG - Icon free download
BiLogoInstagramAlt
instagram, photo, share, social, stories, camera, logo - BoxIcons - BiLogoInstagram - SVG | WEBP | PNG | JPG - Icon free download
BiLogoInstagram
internet, explorer, ie, browser, web, legacy, logo - BoxIcons - BiLogoInternetExplorer - SVG | WEBP | PNG | JPG - Icon free download
BiLogoInternetExplorer
invision, design, prototype, ui, ux, collaboration, logo - BoxIcons - BiLogoInvision - SVG | WEBP | PNG | JPG - Icon free download
BiLogoInvision
java, language, backend, oop, compiler, developer, logo - BoxIcons - BiLogoJava - SVG | WEBP | PNG | JPG - Icon free download
BiLogoJava
kubernetes, k8s, containers, cluster, devops, orchestration - BoxIcons - BiLogoKubernetes - SVG | WEBP | PNG | JPG - Icon free download
BiLogoKubernetes
mailchimp, email, marketing, newsletter, automation, campaign - BoxIcons - BiLogoMailchimp - SVG | WEBP | PNG | JPG - Icon free download
BiLogoMailchimp
meta, facebook, company, brand, social, platform - BoxIcons - BiLogoMeta - SVG | WEBP | PNG | JPG - Icon free download
BiLogoMeta
microsoft, windows, company, software, brand, office - BoxIcons - BiLogoMicrosoft - SVG | WEBP | PNG | JPG - Icon free download
BiLogoMicrosoft
netlify, hosting, deploy, static, site, platform - BoxIcons - BiLogoNetlify - SVG | WEBP | PNG | JPG - Icon free download
BiLogoNetlify
trello, kanban, tasks, project, board, workflow, management - BoxIcons - BiLogoTrello - SVG | WEBP | PNG | JPG - Icon free download
BiLogoTrello
yelp, review, ratings, business, brand, social - BoxIcons - BiLogoYelp - SVG | WEBP | PNG | JPG - Icon free download
BiLogoYelp
youtube, video, play, media, brand, streaming - BoxIcons - BiLogoYoutube - SVG | WEBP | PNG | JPG - Icon free download
BiLogoYoutube
zoom, video, meeting, conference, brand, call - BoxIcons - BiLogoZoom - SVG | WEBP | PNG | JPG - Icon free download
BiLogoZoom
tm, trademark, badge, brand, legal, mark - Bootstrap Icons - BsFillBadgeTmFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeTmFill
bootstrap, framework, ui, css, brand, web - Bootstrap Icons - BsFillBootstrapFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBootstrapFill
disc, cd, dvd, music, media, audio - Bootstrap Icons - BsFillDiscFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDiscFill
kanban, board, tasks, workflow, project, cards, organize - Bootstrap Icons - BsFillKanbanFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillKanbanFill
send, arrow, down, send-arrow-down, download, submit, transfer, message, communication, delivery, forward, downward, ui, button, chat, mail, interaction, upload-alt, workflow - Bootstrap Icons - BsFillSendArrowDownFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSendArrowDownFill
stoplights, traffic-light, signals, traffic, transport, intersection, road, safety, status-indicator, green-yellow-red, map-icon, navigation, warning, control, filled, svg, urban, city, infrastructure, icon - Bootstrap Icons - BsFillStoplightsFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStoplightsFill
terminal, console, command-line, cli, developer, coding, programming, shell, bash, code-run, tech, system-tools, debugging, automation - Bootstrap Icons - BsFillTerminalFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTerminalFill
threads, meta, social, chat, conversation, thread, messaging, microblogging, social-app, brand, network, community - Bootstrap Icons - BsFillThreadsFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillThreadsFill
alexa, amazon, voice, voice-assistant, smart, smart-home, iot, brand, speaker, assistant, ai, command - Bootstrap Icons - BsAlexa - SVG | WEBP | PNG | JPG - Icon free download
BsAlexa
alipay, brand, payment, wallet, china, alibaba, finance, checkout, transaction, online-payment, digital-wallet, qr-payment, ecommerce, mobile-payment, gateway - Bootstrap Icons - BsAlipay - SVG | WEBP | PNG | JPG - Icon free download
BsAlipay
amazon, brand, shopping, ecommerce, retail, marketplace, aws, store, online-shop, cart, prime - Bootstrap Icons - BsAmazon - SVG | WEBP | PNG | JPG - Icon free download
BsAmazon
amd, brand, processor, cpu, gpu, hardware, chip, computing, tech, electronics, ryzen, radeon, semiconductor - Bootstrap Icons - BsAmd - SVG | WEBP | PNG | JPG - Icon free download
BsAmd
android, brand, google, mobile, os, smartphone, development, app, robot, platform, mobile-app - Bootstrap Icons - BsAndroid - SVG | WEBP | PNG | JPG - Icon free download
BsAndroid
android, android2, brand, mobile, os, google, smartphone, app-platform, development, robot, tech - Bootstrap Icons - BsAndroid2 - SVG | WEBP | PNG | JPG - Icon free download
BsAndroid2
apple, ios, mac, macos, iphone, brand, tech, hardware, company, device, store, app-store - Bootstrap Icons - BsApple - SVG | WEBP | PNG | JPG - Icon free download
BsApple
badge, tm, trademark, filled, legal, brand, ip, label, tag, sticker, chip, interface, logo, mark, tm-icon, indicator - Bootstrap Icons - BsBadgeTmFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeTmFill
badge, tm, trademark, outline, legal, brand, ip, label, tag, chip, sticker, logo, indicator, tm-mark, branding - Bootstrap Icons - BsBadgeTm - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeTm
behance, brand, logo, social, portfolio, designers, creative, network, brand-icon, dribbble-alt, ui, link, share, button - Bootstrap Icons - BsBehance - SVG | WEBP | PNG | JPG - Icon free download
BsBehance
bing, brand, search, engine, microsoft, web, internet, seo, query, lookup, browser, logo, branding, ui, navigation - Bootstrap Icons - BsBing - SVG | WEBP | PNG | JPG - Icon free download
BsBing
bootstrap, logo, brand, framework, css, ui-kit, filled, badge, tech, frontend, library, developer, react-icons, web, branding, icon, marketing - Bootstrap Icons - BsBootstrapFill - SVG | WEBP | PNG | JPG - Icon free download
BsBootstrapFill
bootstrap, reboot, logo, brand, css-reset, framework, developer, tooling, settings, badge, react-icons, web, frontend, documentation, icon - Bootstrap Icons - BsBootstrapReboot - SVG | WEBP | PNG | JPG - Icon free download
BsBootstrapReboot
bootstrap, logo, brand, framework, css, ui-kit, frontend, developer, library, badge, react-icons, web, icon, branding - Bootstrap Icons - BsBootstrap - SVG | WEBP | PNG | JPG - Icon free download
BsBootstrap
box, arrow, down, left, box-arrow-down-left, export, download, out, move, direction, navigation, ui, action, workflow, panel, file, button, hover - Bootstrap Icons - BsBoxArrowDownLeft - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowDownLeft
box, arrow, down, right, box-arrow-down-right, export, download, move, direction, ui, navigation, workflow, file, button, hover, panel - Bootstrap Icons - BsBoxArrowDownRight - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowDownRight
box, arrow, down, box-arrow-down, download, import, direction, move, ui, workflow, file, panel, button, hover, storage - Bootstrap Icons - BsBoxArrowDown - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowDown
box, arrow, in, down, left, box-arrow-in-down-left, import, download, move, direction, ui, workflow, file, panel, action - Bootstrap Icons - BsBoxArrowInDownLeft - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInDownLeft
box, arrow, in, down, right, box-arrow-in-down-right, import, download, move, direction, ui, workflow, file, panel, button - Bootstrap Icons - BsBoxArrowInDownRight - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInDownRight
box, arrow, in, down, box-arrow-in-down, import, download, direction, ui, workflow, file, panel, button, hover - Bootstrap Icons - BsBoxArrowInDown - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInDown
box, arrow, in, left, box-arrow-in-left, import, move, direction, ui, workflow, file, panel, action, hover - Bootstrap Icons - BsBoxArrowInLeft - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInLeft
box, arrow, in, right, box-arrow-in-right, import, direction, move, ui, workflow, file, panel, button, hover - Bootstrap Icons - BsBoxArrowInRight - SVG | WEBP | PNG | JPG - Icon free download
BsBoxArrowInRight
bricks, brick-wall, construction, blocks, structure, foundation, grid, layout, build, pattern, wall, masonry, design, stack, components - Bootstrap Icons - BsBricks - SVG | WEBP | PNG | JPG - Icon free download
BsBricks
chrome, google-chrome, browser, web, internet, brand, google, software, web-browser, application, ui, logo - Bootstrap Icons - BsBrowserChrome - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserChrome
edge, microsoft-edge, browser, web, internet, brand, microsoft, software, web-browser, logo, application - Bootstrap Icons - BsBrowserEdge - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserEdge
browser, firefox, mozilla, web, internet, tabs, navigation, search, engine, homepage, ui, toolbar, app, software, window, web-app, bookmark, address-bar, security, open-source, brand - Bootstrap Icons - BsBrowserFirefox - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserFirefox
browser, safari, apple, apple-browser, web, internet, search, engine, navigation, tabs, bookmark, ui, toolbar, macos, ios, window, web-app, address-bar, brand - Bootstrap Icons - BsBrowserSafari - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserSafari
bug, error, issue, debug, filled-bug, test, qa, defect, malware, security, alert, warning, devtools, inspection, problem - Bootstrap Icons - BsBugFill - SVG | WEBP | PNG | JPG - Icon free download
BsBugFill
building, add, new-building, create, infrastructure, construction, real-estate, office, facilities, city, urban, property, management, structure - Bootstrap Icons - BsBuildingAdd - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingAdd
building, check, verified, approved, real-estate, infrastructure, property, inspection, audit, office, city, management, compliance - Bootstrap Icons - BsBuildingCheck - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingCheck
building, dash, remove, minus, reduce, infrastructure, property, management, facility, structure, city, office - Bootstrap Icons - BsBuildingDash - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingDash
building, down, collapse, decline, infrastructure, status, facility, property, office, city, falling, downgrade - Bootstrap Icons - BsBuildingDown - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingDown
building, exclamation, alert, warning, risk, danger, issue, property, facility, infrastructure, office, city - Bootstrap Icons - BsBuildingExclamation - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingExclamation
building, add, filled-building, new, create, infrastructure, real-estate, property, city, office, facility, urban - Bootstrap Icons - BsBuildingFillAdd - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillAdd
building, dash, remove, minus, deactivate, filled-building, property, office, city, infrastructure - Bootstrap Icons - BsBuildingFillDash - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillDash
building, down, decline, drop, filled-building, property, city, analytics, infrastructure, downgrade - Bootstrap Icons - BsBuildingFillDown - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillDown
building, exclamation, warning, alert, danger, filled-building, property, city, infrastructure, risk - Bootstrap Icons - BsBuildingFillExclamation - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillExclamation
building, gear, settings, filled-building, configuration, property, infrastructure, maintenance, office, management - Bootstrap Icons - BsBuildingFillGear - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillGear
building, lock, security, filled-building, access, restricted, property, infrastructure, office, safety - Bootstrap Icons - BsBuildingFillLock - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillLock
building, up, increase, growth, filled-building, property, city, trend, improvement, infrastructure - Bootstrap Icons - BsBuildingFillUp - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillUp
building, x, remove, close, delete, filled-building, property, city, infrastructure, office - Bootstrap Icons - BsBuildingFillX - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillX
building, office, tower, skyscraper, city, structure, real-estate, property, headquarters, enterprise, company, location, map, urban, infrastructure, block, complex, estate, landmark, navigation, ui, header, sidebar, button - Bootstrap Icons - BsBuildingFill - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFill
building, gear, settings, building-settings, maintenance, configure, admin, management, property-management, operations, city, infrastructure, tools, preferences, system, ui, control, setup, optimization - Bootstrap Icons - BsBuildingGear - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingGear
building, office, tower, structure, city, urban, company, real-estate, property, location, map, landmark, enterprise, infrastructure, estate, headquarters - Bootstrap Icons - BsBuilding - SVG | WEBP | PNG | JPG - Icon free download
BsBuilding
buildings, city, skyline, urban, complex, real-estate, property, offices, towers, infrastructure, location, map, block, downtown, metropolis, urban-area - Bootstrap Icons - BsBuildingsFill - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingsFill
buildings, city, skyline, urban, real-estate, towers, complex, property, map, location, block, infrastructure, metropolis, downtown - Bootstrap Icons - BsBuildings - SVG | WEBP | PNG | JPG - Icon free download
BsBuildings
bus, front, vehicle, transport, public-transport, commute, travel, road, shuttle, transit, transportation, city-bus, route, map, stop, station, infrastructure - Bootstrap Icons - BsBusFrontFill - SVG | WEBP | PNG | JPG - Icon free download
BsBusFrontFill
card, checklist, list, task, todo, check, item, form, document, ui-card, workflow, organization - Bootstrap Icons - BsCardChecklist - SVG | WEBP | PNG | JPG - Icon free download
BsCardChecklist
clipboard, check, checked, task, todo, complete, verified, approval, list, document, form, report, notes, ui, dashboard, workflow - Bootstrap Icons - BsClipboardCheckFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardCheckFill
clipboard, check, checkmark, task, todo, complete, approval, verify, list, document, form, notes, workflow, dashboard, ui - Bootstrap Icons - BsClipboardCheck - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardCheck
clipboard, data, chart, stats, metrics, analytics, report, dashboard, document, form, summary, filled, ui, workflow - Bootstrap Icons - BsClipboardDataFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardDataFill
clipboard, data, chart, stats, metrics, analytics, report, document, dashboard, form, summary, ui, workflow - Bootstrap Icons - BsClipboardData - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardData
clipboard, filled, document, paper, notes, task, list, form, report, ui, workflow, dashboard, record, paperwork - Bootstrap Icons - BsClipboardFill - SVG | WEBP | PNG | JPG - Icon free download
BsClipboardFill
clipboard, clipboard2, plus, add, insert, new, document, task, file, record, entry, note, form, outline, ui, button, menu, toolbar-action, office-tool, workflow - Bootstrap Icons - BsClipboard2Plus - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2Plus
clipboard, clipboard2, document, file, note, task, record, form, paper, outline, office, ui, menu-item, toolbar, admin, workflow, checklist - Bootstrap Icons - BsClipboard2 - SVG | WEBP | PNG | JPG - Icon free download
BsClipboard2
cloud, upload, arrow-up, cloud-upload, sync, backup, storage, file-upload, deploy, transfer, network, ui, filled - Bootstrap Icons - BsCloudUploadFill - SVG | WEBP | PNG | JPG - Icon free download
BsCloudUploadFill
cloud, upload, arrow-up, outline, cloud-upload, sync, backup, file-transfer, deploy, network, storage, ui - Bootstrap Icons - BsCloudUpload - SVG | WEBP | PNG | JPG - Icon free download
BsCloudUpload
database, add, new-record, data-add, db, server, storage, cloud-db, insert, plus, table, schema, backend, devops, api, outline - Bootstrap Icons - BsDatabaseAdd - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseAdd
database, check, verified, ok, success, validate, confirm, approve, server, backend, cluster, data-store, sql, nosql, dataset, data-health, status, monitoring, ops, devops, infrastructure, cloud-db, admin, settings, management, green-state, ready, online, tick - Bootstrap Icons - BsDatabaseCheck - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseCheck
database, dash, subtract, remove, minus, reduce, decrement, data, server, backend, cluster, data-store, sql, nosql, dataset, ops, devops, maintenance, action, edit, update - Bootstrap Icons - BsDatabaseDash - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseDash
database, down, offline, error, failure, outage, server, backend, cluster, sql, nosql, ops, devops, data-store, alert, warning, maintenance, critical, system-down, monitoring - Bootstrap Icons - BsDatabaseDown - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseDown
database, exclamation, alert, warning, attention, caution, error, risk, server, backend, cluster, monitoring, ops, devops, data-store, sql, nosql, issue, problem, critical-state - Bootstrap Icons - BsDatabaseExclamation - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseExclamation
database, add, plus, new, create, insert, data, dataset, sql, nosql, server, backend, cluster, storage, expand, grow, add-record, add-entry, admin, ops, devops, action - Bootstrap Icons - BsDatabaseFillAdd - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseFillAdd
database, check, verified, ok, success, validate, approve, server, cluster, backend, sql, nosql, data-store, monitoring, healthy, good-state, green, ops, devops - Bootstrap Icons - BsDatabaseFillCheck - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseFillCheck
database, dash, minus, remove, delete, subtract, reduce, decrement, server, backend, cluster, sql, nosql, data-store, ops, devops, edit, modify - Bootstrap Icons - BsDatabaseFillDash - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseFillDash
database, down, offline, error, failure, outage, server, cluster, backend, sql, nosql, warning, alert, critical, system-down, monitoring, ops, devops - Bootstrap Icons - BsDatabaseFillDown - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseFillDown
database, exclamation, alert, warning, caution, issue, error, problem, server, data-store, sql, nosql, critical, system-warning, monitoring, ops, devops - Bootstrap Icons - BsDatabaseFillExclamation - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseFillExclamation
database, gear, settings, configure, preferences, system, admin, backend, server, sql, nosql, data-store, cluster, ops, devops, tuning, optimization, tools - Bootstrap Icons - BsDatabaseFillGear - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseFillGear
database, up, upload, increase, raise, improve, upgrade, server, backend, cluster, sql, nosql, data-store, ops, devops, sync, cloud, action - Bootstrap Icons - BsDatabaseFillUp - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseFillUp
database, data, storage, server, cluster, sql, nosql, dataset, data-store, backend, ops, devops, cloud, infrastructure, table, records, system - Bootstrap Icons - BsDatabaseFill - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseFill
database, gear, settings, configure, preferences, system, admin, backend, cluster, sql, nosql, data-store, ops, devops, tuning, tools, optimization - Bootstrap Icons - BsDatabaseGear - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseGear
database, up, upload, increase, raise, improve, upgrade, server, backend, cluster, sql, nosql, data-store, ops, devops, sync, cloud - Bootstrap Icons - BsDatabaseUp - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseUp
database, data, storage, db, sql, nosql, server, backend, schema, table, cloud, stack, infrastructure, devops, data-center, io, api, fetch, query, collection, document, cluster, node, instance - Bootstrap Icons - BsDatabase - SVG | WEBP | PNG | JPG - Icon free download
BsDatabase
diagram, flowchart, structure, layout, nodes, connections, process, workflow, business, graph, chart, organization, mapping, visual, filled - Bootstrap Icons - BsDiagram2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsDiagram2Fill
diagram, flowchart, structure, layout, nodes, connections, workflow, process, mapping, thin-line, visual, organization - Bootstrap Icons - BsDiagram2 - SVG | WEBP | PNG | JPG - Icon free download
BsDiagram2
diagram, flowchart, organization-chart, structure, nodes, levels, hierarchy, team, workflow, process, mapping, filled - Bootstrap Icons - BsDiagram3Fill - SVG | WEBP | PNG | JPG - Icon free download
BsDiagram3Fill
diagram, organization-chart, flowchart, hierarchy, nodes, structure, mapping, workflow, team, thin-line, levels - Bootstrap Icons - BsDiagram3 - SVG | WEBP | PNG | JPG - Icon free download
BsDiagram3
disc, cd, dvd, media, music, audio, song, album, record, playlist, music-player, sound, storage, optical-disc, filled, ui, button, multimedia, ios, android, web - Bootstrap Icons - BsDiscFill - SVG | WEBP | PNG | JPG - Icon free download
BsDiscFill
disc, cd, dvd, optical-disc, media, audio, music, album, record, playlist, outline, sound, storage, ui, button, multimedia, minimal, web, ios, android - Bootstrap Icons - BsDisc - SVG | WEBP | PNG | JPG - Icon free download
BsDisc
discord, brand, logo, chat, community, server, gaming, voice-chat, text-chat, social, communication, online, messaging, group, guild, platform, app, icon, android, ios, web - Bootstrap Icons - BsDiscord - SVG | WEBP | PNG | JPG - Icon free download
BsDiscord
dribbble, brand, logo, social, social-media, design, designer-community, portfolio, networking, web, ui, ux, creative, community, platform, branding, marketing - Bootstrap Icons - BsDribbble - SVG | WEBP | PNG | JPG - Icon free download
BsDribbble
dropbox, cloud, cloud-storage, files, file-sharing, sync, backup, brand, logo, folder, document, collaboration, teamwork, storage-service - Bootstrap Icons - BsDropbox - SVG | WEBP | PNG | JPG - Icon free download
BsDropbox
eject, eject-fill, media, control, player, audio, video, dvd, cd, remove, unmount, hardware, device, button, toolbar, ui, ios, android, web, playback, action, triangle, upward, system-control - Bootstrap Icons - BsEjectFill - SVG | WEBP | PNG | JPG - Icon free download
BsEjectFill
facebook, fb, meta, social, brand, logo, network, share, community, profile, social-media - Bootstrap Icons - BsFacebook - SVG | WEBP | PNG | JPG - Icon free download
BsFacebook
file, check, verified, approved, task, completed, done, tick, filled, document, sheet, status, workflow, confirm, ui - Bootstrap Icons - BsFileCheckFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileCheckFill
file, check, verified, approve, task, done, outline, document, sheet, status, workflow, confirm, tick, ui - Bootstrap Icons - BsFileCheck - SVG | WEBP | PNG | JPG - Icon free download
BsFileCheck
file, css, styles, stylesheet, frontend, design, theme, layout, web, ui, styling, syntax, code, developer, vs-code, project, build, assets, webpage, css-file - Bootstrap Icons - BsFiletypeCss - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeCss
file, js, javascript, script, frontend, dynamic, programming, code, developer, syntax, runtime, web, build, project, assets, js-file - Bootstrap Icons - BsFiletypeJs - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeJs
file, jsx, react, component, javascript, frontend, ui, syntax, code, developer, spa, project, build, react-file, script - Bootstrap Icons - BsFiletypeJsx - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeJsx
file, python, py, filetype-py, script, code, automation, data, dev, backend, cli, ai, ml, notebook, runtime, syntax, editor, repo, module - Bootstrap Icons - BsFiletypePy - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypePy
file, raw, filetype-raw, image, photo, camera, uncompressed, editor, photography, media, asset, design, gallery, import, download, attachment, dslr, workflow - Bootstrap Icons - BsFiletypeRaw - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeRaw
file, rb, ruby, filetype-rb, script, code, backend, runtime, syntax, gem, dev, repo, editor, module, cli, project-file, automation - Bootstrap Icons - BsFiletypeRb - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeRb
file, sh, shell, bash, filetype-sh, script, automation, cli, terminal, linux, unix, devops, orchestration, runtime, command, config, system - Bootstrap Icons - BsFiletypeSh - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeSh
file, yml, yaml, config, settings, data, markup, devops, deployment, docker, kubernetes, ci, cd, extension, filetype, infrastructure, document, ui - Bootstrap Icons - BsFiletypeYml - SVG | WEBP | PNG | JPG - Icon free download
BsFiletypeYml
git, version-control, repository, vcs, commit, branch, merge, developer, coding, software, devtools, cli, github, gitlab, bitbucket, workflow, source-code, brand - Bootstrap Icons - BsGit - SVG | WEBP | PNG | JPG - Icon free download
BsGit
github, octocat, git, repo, repository, source-code, developer, open-source, version-control, commit, branch, merge, devtools, coding, brand, profile, social, login - Bootstrap Icons - BsGithub - SVG | WEBP | PNG | JPG - Icon free download
BsGithub
gitlab, git, repository, vcs, ci-cd, devops, runner, merge-request, pipeline, developer, coding, source-control, brand, open-source - Bootstrap Icons - BsGitlab - SVG | WEBP | PNG | JPG - Icon free download
BsGitlab
google-play, play-store, android, google, store, app-store, download, install, mobile-app, brand, media, music, movies, apps, triangle-icon - Bootstrap Icons - BsGooglePlay - SVG | WEBP | PNG | JPG - Icon free download
BsGooglePlay
google, search, brand, logo, gmail, android, web, login, oauth, signin, profile, internet, browser, technology - Bootstrap Icons - BsGoogle - SVG | WEBP | PNG | JPG - Icon free download
BsGoogle
hammer, tool, hardware, construction, build, repair, work, fix, diy, craft, strike, impact, maintenance, equipment, utility, workshop, action - Bootstrap Icons - BsHammer - SVG | WEBP | PNG | JPG - Icon free download
BsHammer
hdd, network, network-drive, nas, filled, storage, server, data, infrastructure, cloud, shared-drive, hardware, backup, device - Bootstrap Icons - BsHddNetworkFill - SVG | WEBP | PNG | JPG - Icon free download
BsHddNetworkFill
hdd, network, network-drive, nas, outline, storage, hardware, server, cloud, infrastructure, shared-drive, backup, data - Bootstrap Icons - BsHddNetwork - SVG | WEBP | PNG | JPG - Icon free download
BsHddNetwork
hdd, rack, server-rack, storage, datacenter, filled, infrastructure, server, hardware, stack, data, it - Bootstrap Icons - BsHddRackFill - SVG | WEBP | PNG | JPG - Icon free download
BsHddRackFill
hdd, rack, server-rack, outline, storage, hardware, data, infrastructure, datacenter, it, device - Bootstrap Icons - BsHddRack - SVG | WEBP | PNG | JPG - Icon free download
BsHddRack
hdd, stack, storage, outline, multi-drive, hardware, server, backup, layers, capacity, it, infrastructure - Bootstrap Icons - BsHddStack - SVG | WEBP | PNG | JPG - Icon free download
BsHddStack
hourglass, top, hourglass-top, timer, countdown, waiting, loading, progress, duration, time-limit, time-tracking, clock, indicator, ui, status, task, workflow, delay - Bootstrap Icons - BsHourglassTop - SVG | WEBP | PNG | JPG - Icon free download
BsHourglassTop
hourglass, sandclock, timer, wait, loading, duration, countdown, progress, delay, time-management, ui, indicator, workflow, schedule, clock - Bootstrap Icons - BsHourglass - SVG | WEBP | PNG | JPG - Icon free download
BsHourglass
instagram, brand, logo, social, social-media, camera, stories, photo-sharing, reels, marketing, influencer, profile, app-icon - Bootstrap Icons - BsInstagram - SVG | WEBP | PNG | JPG - Icon free download
BsInstagram
kanban, board, task, workflow, project, filled, card, todo, manage, track - Bootstrap Icons - BsKanbanFill - SVG | WEBP | PNG | JPG - Icon free download
BsKanbanFill
kanban, board, task, workflow, project, outline, todo, management, tracking - Bootstrap Icons - BsKanban - SVG | WEBP | PNG | JPG - Icon free download
BsKanban
line, brand, line-app, messaging, chat, im, communication, social, platform, logo, sms, mobile, japan, korea - Bootstrap Icons - BsLine - SVG | WEBP | PNG | JPG - Icon free download
BsLine
linkedin, brand, logo, social, networking, professional, career, business, resume, profile, job, company, platform - Bootstrap Icons - BsLinkedin - SVG | WEBP | PNG | JPG - Icon free download
BsLinkedin
magic, wand, sparkle, effect, tool, edit, enhance, creative, design, filter, ui, app, wizard, automation, special-effects - Bootstrap Icons - BsMagic - SVG | WEBP | PNG | JPG - Icon free download
BsMagic
mastodon, brand, logo, social, network, federated, microblogging, activitypub, fediverse, communication, platform, profile, avatar, share, post, ui, header, footer, brand-icon - Bootstrap Icons - BsMastodon - SVG | WEBP | PNG | JPG - Icon free download
BsMastodon
medium, brand, logo, writing, blog, article, publisher, content, read, share, platform, social, publication, editorial, story, post, brand-icon - Bootstrap Icons - BsMedium - SVG | WEBP | PNG | JPG - Icon free download
BsMedium
messenger, facebook-messenger, chat, brand, logo, message, dm, im, communication, send, social, platform, bubble, conversation, share, brand-icon - Bootstrap Icons - BsMessenger - SVG | WEBP | PNG | JPG - Icon free download
BsMessenger
meta, facebook, brand, logo, company, social, technology, platform, vr, ar, corporate, brand-icon - Bootstrap Icons - BsMeta - SVG | WEBP | PNG | JPG - Icon free download
BsMeta
microsoft, teams, microsoft-teams, brand, logo, chat, collaboration, communication, video-call, meeting, workplace, office, enterprise, productivity, teamwork, group-chat, messaging, remote-work, desktop, webapp, button, navbar, sidebar - Bootstrap Icons - BsMicrosoftTeams - SVG | WEBP | PNG | JPG - Icon free download
BsMicrosoftTeams
microsoft, brand, logo, windows, office, tech, software, corporate, company, ms, brandmark, enterprise, desktop, ecosystem, productivity, technology-company, webapp, navbar, footer - Bootstrap Icons - BsMicrosoft - SVG | WEBP | PNG | JPG - Icon free download
BsMicrosoft
nintendo, switch, gaming, console, brand, nintendo-switch, joycon, portable-console, video-games, entertainment, handheld - Bootstrap Icons - BsNintendoSwitch - SVG | WEBP | PNG | JPG - Icon free download
BsNintendoSwitch
nvidia, brand, gpu, graphics-card, rtx, geforce, hardware, ai, machine-learning, computing, tech - Bootstrap Icons - BsNvidia - SVG | WEBP | PNG | JPG - Icon free download
BsNvidia
open, collective, opencollective, brand, logo, community, funding, donations, open-source, organization, nonprofit, badge, symbol, platform, crowdfunding - Bootstrap Icons - BsOpencollective - SVG | WEBP | PNG | JPG - Icon free download
BsOpencollective
paypal, brand, payment, ecommerce, money, transaction, checkout, wallet, gateway, online-payment, logo - Bootstrap Icons - BsPaypal - SVG | WEBP | PNG | JPG - Icon free download
BsPaypal
peace, symbol, peace-fill, culture, spiritual, harmony, sign, icon, decorative, badge, logo, mark, simple, ui - Bootstrap Icons - BsPeaceFill - SVG | WEBP | PNG | JPG - Icon free download
BsPeaceFill
peace, symbol, outline, harmony, unity, culture, spiritual, sign, decorative, ui, logo, mark - Bootstrap Icons - BsPeace - SVG | WEBP | PNG | JPG - Icon free download
BsPeace
pinterest, brand, logo, social, social-media, share, pin, board, content, images, inspiration, marketing, platform, pinterest-brand, social-share - Bootstrap Icons - BsPinterest - SVG | WEBP | PNG | JPG - Icon free download
BsPinterest
playstation, sony, ps, console, gaming, brand, logo, game, controller, platform, entertainment, ps5, ps4 - Bootstrap Icons - BsPlaystation - SVG | WEBP | PNG | JPG - Icon free download
BsPlaystation
quora, brand, logo, social, platform, qna, questions, answers, community, discussion, red-logo, app, service - Bootstrap Icons - BsQuora - SVG | WEBP | PNG | JPG - Icon free download
BsQuora
reddit, brand, logo, social, community, discussion, threads, posts, forum, platform, sharing, avatar, alien, outline - Bootstrap Icons - BsReddit - SVG | WEBP | PNG | JPG - Icon free download
BsReddit
robot, bot, ai, automation, machine, android, tech, technology, robotics, assistant, chatbot, automation, iot, device, gadget, toy, avatar, character, automation-ui - Bootstrap Icons - BsRobot - SVG | WEBP | PNG | JPG - Icon free download
BsRobot
screwdriver, tool, fix, repair, maintenance, hardware, construction, build, adjust, tighten - Bootstrap Icons - BsScrewdriver - SVG | WEBP | PNG | JPG - Icon free download
BsScrewdriver
server, hosting, backend, database, api, cloud, infrastructure, rack, hardware, storage, compute, network, devops, deployment, sysadmin, bootstrap, line-icon - Bootstrap Icons - BsServer - SVG | WEBP | PNG | JPG - Icon free download
BsServer
sina, weibo, sina-weibo, china, microblogging, social, platform, brand, logo, network, sharing, community, post, feed - Bootstrap Icons - BsSinaWeibo - SVG | WEBP | PNG | JPG - Icon free download
BsSinaWeibo
skype, brand, microsoft, chat, messaging, video-call, voice-call, communication, meeting, conference, collaboration, team, contact, online, social, platform, logo, brand-icon, communication-tool, softphone - Bootstrap Icons - BsSkype - SVG | WEBP | PNG | JPG - Icon free download
BsSkype
slack, brand, logo, team, workspace, communication, collaboration, chat, messaging, channels, work, office, productivity, online, platform, brand-icon, remote-work, team-chat, business-tool - Bootstrap Icons - BsSlack - SVG | WEBP | PNG | JPG - Icon free download
BsSlack
snapchat, snap, snapchat-logo, brand, social, social-network, messaging, stories, camera, share, profile, auth, oauth, social-icon, bootstrap, icon - Bootstrap Icons - BsSnapchat - SVG | WEBP | PNG | JPG - Icon free download
BsSnapchat
sourceforge, brand, logo, open-source, software, development, projects, repo, community, coding, dev, platform - Bootstrap Icons - BsSourceforge - SVG | WEBP | PNG | JPG - Icon free download
BsSourceforge
spotify, brand, logo, music, streaming, playlist, audio, app, entertainment, media, sound - Bootstrap Icons - BsSpotify - SVG | WEBP | PNG | JPG - Icon free download
BsSpotify
stackoverflow, brand, logo, programming, developer, coding, questions, answers, community, dev, platform, tech - Bootstrap Icons - BsStackOverflow - SVG | WEBP | PNG | JPG - Icon free download
BsStackOverflow
steam, brand, gaming, valve, platform, game-platform, pc-games, launcher, store, game-store, community, profile, badge, logo, brand-logo, games, multiplayer, pc, desktop, client - Bootstrap Icons - BsSteam - SVG | WEBP | PNG | JPG - Icon free download
BsSteam
strava, brand, fitness, tracking, run, cycle, exercise, workout, community, sport, gps, map, health, activity, logo, brand-logo - Bootstrap Icons - BsStrava - SVG | WEBP | PNG | JPG - Icon free download
BsStrava
stripe, brand, payment, checkout, pay, online-payments, gateway, billing, invoice, subscription, finance, merchant, card-payments, logo - Bootstrap Icons - BsStripe - SVG | WEBP | PNG | JPG - Icon free download
BsStripe
substack, brand, blog, newsletter, writer, publication, content, media, post, article, platform, logo, brand-logo, email-newsletter, creator - Bootstrap Icons - BsSubstack - SVG | WEBP | PNG | JPG - Icon free download
BsSubstack
telegram, brand, logo, messaging, chat, send, communication, social, app, share, platform - Bootstrap Icons - BsTelegram - SVG | WEBP | PNG | JPG - Icon free download
BsTelegram
tencent, qq, brand, logo, messenger, chat, social, networking, china, profile, avatar, contact, im, communication, app, platform - Bootstrap Icons - BsTencentQq - SVG | WEBP | PNG | JPG - Icon free download
BsTencentQq
threads, threads-fill, meta, instagram-threads, brand, social, network, platform, logo, chat, feed, community, conversation, profile, social-media, ios, android, web - Bootstrap Icons - BsThreadsFill - SVG | WEBP | PNG | JPG - Icon free download
BsThreadsFill
threads, meta, instagram-threads, brand, platform, social, communication, chat, feed, logo, social-media, community, conversation, profile, ios, android - Bootstrap Icons - BsThreads - SVG | WEBP | PNG | JPG - Icon free download
BsThreads
tiktok, brand, logo, social, social-media, video, short-video, creator, influencer, entertainment, music, app, platform, share, media, marketing - Bootstrap Icons - BsTiktok - SVG | WEBP | PNG | JPG - Icon free download
BsTiktok
trello, brand, logo, board, kanban, task, project, work, management - Bootstrap Icons - BsTrello - SVG | WEBP | PNG | JPG - Icon free download
BsTrello
twitch, brand, logo, streaming, live-stream, gaming, esports, social, media, video, content-creator, platform - Bootstrap Icons - BsTwitch - SVG | WEBP | PNG | JPG - Icon free download
BsTwitch
twitter, x, twitter-x, brand, logo, social, media, microblog, tweet, post, share, platform - Bootstrap Icons - BsTwitterX - SVG | WEBP | PNG | JPG - Icon free download
BsTwitterX
twitter, bird, tweet, brand, logo, social, media, microblog, post, share, community - Bootstrap Icons - BsTwitter - SVG | WEBP | PNG | JPG - Icon free download
BsTwitter
ubuntu, linux, os, operating-system, brand, logo, software, open-source, distribution, development, terminal, server - Bootstrap Icons - BsUbuntu - SVG | WEBP | PNG | JPG - Icon free download
BsUbuntu
unity, brand, engine, game-engine, game-dev, 3d, development, graphics, vr, ar, editor, unity-logo - Bootstrap Icons - BsUnity - SVG | WEBP | PNG | JPG - Icon free download
BsUnity
usb, usb-symbol, universal-serial-bus, icon, symbol, tech, hardware, connector, data-transfer, charging, standard, logo, outline, settings, system - Bootstrap Icons - BsUsbSymbol - SVG | WEBP | PNG | JPG - Icon free download
BsUsbSymbol
vimeo, brand, logo, video, hosting, streaming, media, social, platform, content, creator, share, publish, brand-icon, video-platform - Bootstrap Icons - BsVimeo - SVG | WEBP | PNG | JPG - Icon free download
BsVimeo
wechat, brand, chat, message, social, communication, app, logo, china, platform - Bootstrap Icons - BsWechat - SVG | WEBP | PNG | JPG - Icon free download
BsWechat
whatsapp, brand, chat, messaging, communication, logo, phone, social, app - Bootstrap Icons - BsWhatsapp - SVG | WEBP | PNG | JPG - Icon free download
BsWhatsapp
wikipedia, wiki, brand, encyclopedia, knowledge, content, reference, education, learning, articles, information - Bootstrap Icons - BsWikipedia - SVG | WEBP | PNG | JPG - Icon free download
BsWikipedia
window, stack, layers, multiple-windows, tabs, panels, ui-window, desktop, container, workflow - Bootstrap Icons - BsWindowStack - SVG | WEBP | PNG | JPG - Icon free download
BsWindowStack
windows, microsoft, os, brand, desktop, system, logo, software, pc, computer - Bootstrap Icons - BsWindows - SVG | WEBP | PNG | JPG - Icon free download
BsWindows
wordpress, wp, cms, blog, brand, website, publishing, platform, content, editor - Bootstrap Icons - BsWordpress - SVG | WEBP | PNG | JPG - Icon free download
BsWordpress
xbox, brand, microsoft, gaming, console, xbox-logo, entertainment, gamepad, controller, xbox-live - Bootstrap Icons - BsXbox - SVG | WEBP | PNG | JPG - Icon free download
BsXbox
yelp, brand, review, rating, restaurant, business, directory, local, social, platform - Bootstrap Icons - BsYelp - SVG | WEBP | PNG | JPG - Icon free download
BsYelp
youtube, brand, video, media, play, content, channel, streaming, social, creator - Bootstrap Icons - BsYoutube - SVG | WEBP | PNG | JPG - Icon free download
BsYoutube
adidas, brand, logo, sportswear, shoe-brand, apparel, fashion, sport, training, athletic, merchandise, brand-identity, storefront, ecommerce, brand-mark, badge, branding - css.gg Icons - CgAdidas - SVG | WEBP | PNG | JPG - Icon free download
CgAdidas
apple, watch, apple-watch, wearable, smartwatch, ios, device, technology, fitness-tracker, electronics, brand, gadget, mobile - css.gg Icons - CgAppleWatch - SVG | WEBP | PNG | JPG - Icon free download
CgAppleWatch
assign, task, responsibility, set, allocate, project, workflow, team, job, todo, ui-action, task-manager - css.gg Icons - CgAssign - SVG | WEBP | PNG | JPG - Icon free download
CgAssign
atlassian, brand, jira, confluence, bitbucket, logo, teamwork, devops, collaboration, project-tools, software - css.gg Icons - CgAtlasian - SVG | WEBP | PNG | JPG - Icon free download
CgAtlasian
bitbucket, brand, logo, atlassian, git, repository, source-code, devops, collaboration, software - css.gg Icons - CgBitbucket - SVG | WEBP | PNG | JPG - Icon free download
CgBitbucket
bmw, brand, car, automotive, vehicle, logo, luxury, transport, motor, company - css.gg Icons - CgBmw - SVG | WEBP | PNG | JPG - Icon free download
CgBmw
bot, robot, ai, automation, assistant, chatbot, virtual-agent, machine, tech, robot-face, bot-head, service-bot, support, automation-tool - css.gg Icons - CgBot - SVG | WEBP | PNG | JPG - Icon free download
CgBot
c++, cplusplus, coding, developer, software, programming, compiler, source-code, language, backend, frontend, system-programming, cpp-logo, brand, learning, ide, code-editor - css.gg Icons - CgCPlusPlus - SVG | WEBP | PNG | JPG - Icon free download
CgCPlusPlus
calibrate, adjust, tune, settings, measurement, precision, accuracy, optimize, tools, configuration, engineering, workflow - css.gg Icons - CgCalibrate - SVG | WEBP | PNG | JPG - Icon free download
CgCalibrate
chanel, brand, logo, fashion, luxury, designer, clothing, perfume, accessories, style, boutique, ecommerce - css.gg Icons - CgChanel - SVG | WEBP | PNG | JPG - Icon free download
CgChanel
cg, circleci, circle ci, ci, continuous-integration, devops, build, pipeline, automation, integration, github, gitlab, deployment, brand, logo, badge, developer, tooling, platform - css.gg Icons - CgCircleci - SVG | WEBP | PNG | JPG - Icon free download
CgCircleci
cg, codeclimate, code climate, brand, logo, developer, quality, lint, analysis, ci, code-quality, metrics, dashboard, tooling, platform, badge, integration - css.gg Icons - CgCodeClimate - SVG | WEBP | PNG | JPG - Icon free download
CgCodeClimate
comedy, central, comedy-central, brand, logo, tv, media, entertainment, channel, network, brand-icon, show, humor, funny - css.gg Icons - CgComedyCentral - SVG | WEBP | PNG | JPG - Icon free download
CgComedyCentral
copyright, c-symbol, legal, rights, intellectual-property, ip, ownership, brand, protection, law, license, notice, symbol - css.gg Icons - CgCopyright - SVG | WEBP | PNG | JPG - Icon free download
CgCopyright
crowdfire, brand, logo, social, media, marketing, automation, content, scheduler, app, platform, influencer, engagement, promotion, branding, social-media - css.gg Icons - CgCrowdfire - SVG | WEBP | PNG | JPG - Icon free download
CgCrowdfire
database, db, storage, server, sql, nosql, datastore, records, tables, backend, infrastructure, data-center, cloud, stack, devops, admin - css.gg Icons - CgDatabase - SVG | WEBP | PNG | JPG - Icon free download
CgDatabase
designmodo, brand, logo, design, ui, ux, framework, builder, website, platform, marketing, branding, content, tool, web - css.gg Icons - CgDesignmodo - SVG | WEBP | PNG | JPG - Icon free download
CgDesignmodo
desktop, computer, monitor, screen, pc, display, workstation, device, setup, ui, window, dashboard, workspace, hardware, electronics, home screen, office desk, system ui, toolbar icon, menu icon, panel, layout, productivity, coding setup, developer tools, tech - css.gg Icons - CgDesktop - SVG | WEBP | PNG | JPG - Icon free download
CgDesktop
digitalocean, do, cloud, hosting, server, vps, droplet, brand, devops, infrastructure, deployment, cloud provider, saas platform, hosting service, api, compute, docker, kubernetes, platform, developer tools - css.gg Icons - CgDigitalocean - SVG | WEBP | PNG | JPG - Icon free download
CgDigitalocean
disc, cd, dvd, media, music, album, track, audio, playlist, storage, record, optical disc, collection, file icon, library, sound, player, ui button, toolbox, asset - css.gg Icons - CgDisc - SVG | WEBP | PNG | JPG - Icon free download
CgDisc
dolby, brand, audio, surround sound, dolby audio, dolby digital, cinema, hd audio, sound quality, speaker, streaming, movie, tv, theater, sound tech, audio enhancement, media playback, entertainment, sound system, hi fi, immersive sound - css.gg Icons - CgDolby - SVG | WEBP | PNG | JPG - Icon free download
CgDolby
dribbble, design, brand, designer community, portfolio, shots, creative network, ui design, ux design, graphics, inspiration, social, profile, logo, community, art, visual design, creative work, gallery, showcase, branding, social media, dribble - css.gg Icons - CgDribbble - SVG | WEBP | PNG | JPG - Icon free download
CgDribbble
duplicate, copy, clone, duplicate file, duplicate item, documents, files, clipboard, copy action, editor, ui control, copy paste, content duplication, replicate, duplicate block, productivity, workflow, form tools, page copy, multiple items - css.gg Icons - CgDuplicate - SVG | WEBP | PNG | JPG - Icon free download
CgDuplicate
mask, edit mask, layer mask, selection, cutout, image mask, photo edit, editor, design tool, masking, overlay, alpha mask, vector mask, ui tool, panel, workflow, effects, highlight, adjustment mask - css.gg Icons - CgEditMask - SVG | WEBP | PNG | JPG - Icon free download
CgEditMask
eject, media eject, remove, disk eject, device, cd, dvd, usb, safely remove, media control, button, playback, stop, hardware action, storage, system control, exit, popup, tray, drive - css.gg Icons - CgEject - SVG | WEBP | PNG | JPG - Icon free download
CgEject
enter, keyboard enter, return, submit, confirm, proceed, action key, login, access, form submit, navigation, button, ui control, input, shortcut, key press, command, interaction, workflow, continue - css.gg Icons - CgEnter - SVG | WEBP | PNG | JPG - Icon free download
CgEnter
ericsson, brand, telecom, network, communication, 5g, mobile network, equipment, infrastructure, connectivity, corporate, technology, wireless, iot, signal, antenna, provider, telecommunications - css.gg Icons - CgEricsson - SVG | WEBP | PNG | JPG - Icon free download
CgEricsson
ethernet, lan, network cable, wired network, connection, port, internet, router, switch, infrastructure, hardware, signal, data, communication, technology, link, connector, cable, network device, wired - css.gg Icons - CgEthernet - SVG | WEBP | PNG | JPG - Icon free download
CgEthernet
eventbrite, brand, events, tickets, event platform, booking, ticketing, promotion, marketing, social event, entertainment, planning, schedule, organizer, event app, business event, conference, meetup, tickets online, brand icon - css.gg Icons - CgEventbrite - SVG | WEBP | PNG | JPG - Icon free download
CgEventbrite
export, share, upload, send, external, arrow out, file action, data transfer, save as, output, share file, ui button, toolbar, menu, action, document, cloud, integration, workflow - css.gg Icons - CgExport - SVG | WEBP | PNG | JPG - Icon free download
CgExport
facebook, fb, social media, brand, logo, network, community, share, post, platform, messaging, profile, timeline, social network, meta, promotion, marketing, follow - css.gg Icons - CgFacebook - SVG | WEBP | PNG | JPG - Icon free download
CgFacebook
file remove, delete file, remove, trash, document remove, clear, minus, file, document, cleanup, archive, discard, action, toolbar, ui, workflow - css.gg Icons - CgFileRemove - SVG | WEBP | PNG | JPG - Icon free download
CgFileRemove
framer, framer brand, framer logo, design tool, prototyping, ui design, ux design, animation, interaction design, creative tool, brand, logo, product design, mockup, wireframe, web app, mobile app, design system, frontend, no code, visual editor - css.gg Icons - CgFramer - SVG | WEBP | PNG | JPG - Icon free download
CgFramer
git, branch, git branch, version control, merge, feature branch, repo, repository, source control, vcs, workflow, collaboration, code flow, tree, development, devops, engineering, commit chain, sidebar, toolbar, header icon, navigation, branching model, pull request, merge request, software - css.gg Icons - CgGitBranch - SVG | WEBP | PNG | JPG - Icon free download
CgGitBranch
git, commit, git commit, checkpoint, version control, repo, repository, vcs, code change, snapshot, source control, dot, commit dot, development, devops, log, history, timeline, code review, engineering, toolbar, status, software - css.gg Icons - CgGitCommit - SVG | WEBP | PNG | JPG - Icon free download
CgGitCommit
git, fork, git fork, repo fork, repository, version control, vcs, clone, branch, code copy, source control, development, devops, engineering, workflow, code split, upstream, downstream, toolbar, sidebar, software - css.gg Icons - CgGitFork - SVG | WEBP | PNG | JPG - Icon free download
CgGitFork
git, pull, git pull, fetch, sync, merge, update, repository, repo, version control, vcs, source control, development, devops, engineering, workflow, sync code, collaboration, toolbar, nav, software - css.gg Icons - CgGitPull - SVG | WEBP | PNG | JPG - Icon free download
CgGitPull
gitter, brand, gitter brand, chat, messaging, developer chat, community, open source, collaboration, communication, team chat, channel, forum, discussion, sidebar, toolbar, logo, social platform, software - css.gg Icons - CgGitter - SVG | WEBP | PNG | JPG - Icon free download
CgGitter
google, tasks, google tasks, brand, checklist, todo, task list, productivity, planner, schedule, organization, task manager, workflow, reminders, planning, office, work, project management, task app, list icon, mobile ui, web app - css.gg Icons - CgGoogleTasks - SVG | WEBP | PNG | JPG - Icon free download
CgGoogleTasks
google, brand, logo, search, engine, internet, browser, gmail, maps, drive, workspace, web, chrome, android, seo, indexing, homepage, header icon, footer icon, sidebar icon - css.gg Icons - CgGoogle - SVG | WEBP | PNG | JPG - Icon free download
CgGoogle
if design, conditional design, design logic, ui design, editor, builder, layout control, conditional block, toggle logic, node editor, workflow, programming ui, designer tool, frontend editing, visual editor, logic flow, conditional ui, toggle element, page builder - css.gg Icons - CgIfDesign - SVG | WEBP | PNG | JPG - Icon free download
CgIfDesign
indie hackers, indiehackers, brand, community, startup founders, makers, entrepreneurs, bootstrappers, saas community, tech group, product builders, founder club, indie dev, creator economy, startup forum, business networking, software makers - css.gg Icons - CgIndieHackers - SVG | WEBP | PNG | JPG - Icon free download
CgIndieHackers
insert, after, insert after, add, append, place after, cursor, editor, text edit, markdown, wysiwyg, layout edit, positioning, ui control, sidebar action, toolbar button, content creation, workflow, modifier - css.gg Icons - CgInsertAfter - SVG | WEBP | PNG | JPG - Icon free download
CgInsertAfter
insert, before, insert before, add, prepend, place before, editor, cursor, text edit, markdown, wysiwyg, layout control, ui tool, modifier icon, content creation, workflow, inputs - css.gg Icons - CgInsertBeforeO - SVG | WEBP | PNG | JPG - Icon free download
CgInsertBeforeO
insert, before, insert before, add, prepend, editor control, text edit, cursor icon, layout builder, ui placement, document editing, workflow, modifier, page builder - css.gg Icons - CgInsertBeforeR - SVG | WEBP | PNG | JPG - Icon free download
CgInsertBeforeR
insert, before, insert before, add, prepend, cursor, editor, layout control, text editor, markdown, wysiwyg, ui action, modifier tool, workflow, document editing - css.gg Icons - CgInsertBefore - SVG | WEBP | PNG | JPG - Icon free download
CgInsertBefore
instagram, social, brand, ig, photo, camera, share, social media, stories, reels, followers, profile, feed, influencer, marketing, community, logo, app icon - css.gg Icons - CgInstagram - SVG | WEBP | PNG | JPG - Icon free download
CgInstagram
internal, inside, intranet, private, restricted, access, internal link, workflow, system route, navigation, protected, organization, role-based, secure area, ui element - css.gg Icons - CgInternal - SVG | WEBP | PNG | JPG - Icon free download
CgInternal
lastpass, brand, password manager, security, auth, login, credentials, vault, key, 2fa, identity management, privacy, password generator, browser extension, cloud security, safe login, account protection, credential storage - css.gg Icons - CgLastpass - SVG | WEBP | PNG | JPG - Icon free download
CgLastpass
mail reply, reply, email reply, message reply, respond, answer, inbox, communication, arrow back, email action, reply thread, conversation, support response, team messaging, material reply, ios mail, android mail, customer support, helpdesk, workflow - css.gg Icons - CgMailReply - SVG | WEBP | PNG | JPG - Icon free download
CgMailReply
merge, horizontal, merge horizontal, combine, join, align, layout, ui, grid, columns, rows, arrange, editor, design, interface, workflow, toolbar, action, organize, page builder, responsive layout, split, unify - css.gg Icons - CgMergeHorizontal - SVG | WEBP | PNG | JPG - Icon free download
CgMergeHorizontal
merge, vertical, merge vertical, combine, join, stack, align, layout, ui, rows, columns, arrange, editor, design, interface, workflow, toolbar, action, organize, builder, page structure, responsive - css.gg Icons - CgMergeVertical - SVG | WEBP | PNG | JPG - Icon free download
CgMergeVertical
microsoft, brand, windows, office, teams, azure, tech company, software, enterprise, productivity, cloud services, ms, logo, suite, apps, saas, operating system, developer tools, business tools - css.gg Icons - CgMicrosoft - SVG | WEBP | PNG | JPG - Icon free download
CgMicrosoft
npm, node package manager, package manager, nodejs, javascript, js, developer, dev tools, package registry, bundle, module, cli, software, ecosystem, repo, build tools, frontend, backend, dependency, brand, logo, package install, package update, coding workflow - css.gg Icons - CgNpm - SVG | WEBP | PNG | JPG - Icon free download
CgNpm
oculus, meta, vr, virtual reality, headset, gaming, vr device, immersive, 3d, simulation, vr experience, technology brand, logo, hardware, goggles, vr platform, gaming gear, entertainment, brand icon - css.gg Icons - CgOculus - SVG | WEBP | PNG | JPG - Icon free download
CgOculus
open collective, funding, community, open source, donations, contributors, crowdfunding, support, collaboration, sponsorship, organization, brand, logo, teams, community group, financial support, ecosystem - css.gg Icons - CgOpenCollective - SVG | WEBP | PNG | JPG - Icon free download
CgOpenCollective
organisation, organization, hierarchy, structure, team, company, business, groups, workflow, chart, org chart, department, corporate, roles, users, collaboration, management, network, enterprise, diagram - css.gg Icons - CgOrganisation - SVG | WEBP | PNG | JPG - Icon free download
CgOrganisation
overflow, stack overflow, stackoverflow, dev community, developer, programming, coding, qa, questions, answers, forum, knowledge base, brand, logo, developer tools, tech community, software help, documentation - css.gg Icons - CgOverflow - SVG | WEBP | PNG | JPG - Icon free download
CgOverflow
patreon, brand, social, creator platform, membership, subscription, support creators, crowdfunding, logo, badge, icon, influencer, content creator, donation, funding - css.gg Icons - CgPatreon - SVG | WEBP | PNG | JPG - Icon free download
CgPatreon
paypal, brand, payment, checkout, finance, wallet, transaction, online payment, ecommerce, logo, badge, merchant, billing, digital wallet, secure payment - css.gg Icons - CgPaypal - SVG | WEBP | PNG | JPG - Icon free download
CgPaypal
pexels, brand, photo stock, stock images, media library, gallery, photos, image asset, creative commons, photography, pictures, content, visuals, media, download, upload, share, browser, portfolio, designer, editor, creative, resource, image manager - css.gg Icons - CgPexels - SVG | WEBP | PNG | JPG - Icon free download
CgPexels
pokemon, brand, gaming, game, pokeball, anime, nintendo, creatures, monster, collectibles, fandom, entertainment, franchise, logo, badge, iconic, pop culture - css.gg Icons - CgPokemon - SVG | WEBP | PNG | JPG - Icon free download
CgPokemon
producthunt, product hunt, brand, logo, startup, launch, community, tech, product discovery, platform, marketing, badge, social, startup ecosystem, promotion - css.gg Icons - CgProductHunt - SVG | WEBP | PNG | JPG - Icon free download
CgProductHunt
redo, repeat, forward action, restore, reapply, edit, history, action step, ui control, toolbar button, editor tool, timeline, undo redo, workflow, command, android, ios, cursor action, shortcut - css.gg Icons - CgRedo - SVG | WEBP | PNG | JPG - Icon free download
CgRedo
remote, controller, remote control, iot, device, media, tv remote, smart home, automation, bluetooth, signal, infrared, control panel, electronics, settings, input device, android, ios, ui control - css.gg Icons - CgRemote - SVG | WEBP | PNG | JPG - Icon free download
CgRemote
server, backend, host, hosting, cloud server, compute, datacenter, rack, deployment, stack, infrastructure, api backend, load balancer, sysadmin, devops, network, storage unit, web hosting, cluster, virtual machine, docker, kubernetes - css.gg Icons - CgServer - SVG | WEBP | PNG | JPG - Icon free download
CgServer
shortcut, quick action, hotkey, key command, fast access, jump, navigate, link, arrow shortcut, productivity, workflow, speed, fast navigation, ios, android, macos, windows, ux, ui tool, toolbar action - css.gg Icons - CgShortcut - SVG | WEBP | PNG | JPG - Icon free download
CgShortcut
shutterstock, brand, stock images, stock photos, media library, creative assets, content marketplace, photo service, image bank, design resources, licensed images, photography stock, branding icon, logo, asset repository, digital media - css.gg Icons - CgShutterstock - SVG | WEBP | PNG | JPG - Icon free download
CgShutterstock
slack, brand, chat, messaging, team, workspace, collaboration, communication, work chat, channels, dm, company communication, remote work, notifications, productivity app, teamwork, group chat, workflows - css.gg Icons - CgSlack - SVG | WEBP | PNG | JPG - Icon free download
CgSlack
smart home, refrigerator, fridge, kitchen appliance, iot, cooling, food storage, household, connected device, automation, sensor, kitchen tech, cold storage, appliance control, smart kitchen, cool - css.gg Icons - CgSmartHomeRefrigerator - SVG | WEBP | PNG | JPG - Icon free download
CgSmartHomeRefrigerator
stack, layers, pile, documents, server stack, cloud layers, multi layer, tier, architecture, backend, infrastructure, collection, nested items, data grouping, layered ui, css gg - css.gg Icons - CgStack - SVG | WEBP | PNG | JPG - Icon free download
CgStack
terminal, console, command line, cli, shell, code, developer, programming, bash, zsh, server, debugging, admin, root access, system tools, devops, scripting, automation, coding environment, tech - css.gg Icons - CgTerminal - SVG | WEBP | PNG | JPG - Icon free download
CgTerminal
toolbox, tools, kit, work tools, repair, maintenance, builder, developer tools, settings, gear, utilities, hardware, construction, workshop, equipment, ui tools, toolbar, admin, configuration, setup, fix, patch, upgrade, utility box, portable tools, engineer tools, craftsman - css.gg Icons - CgToolbox - SVG | WEBP | PNG | JPG - Icon free download
CgToolbox
trello, brand, kanban, boards, tasks, project management, collaboration, productivity, planning, workflow, task board, scrum, agile, jira alternative, team work, organize, lists, cards, project tracking, team tools, planning board - css.gg Icons - CgTrello - SVG | WEBP | PNG | JPG - Icon free download
CgTrello
twilio, brand, communication, sms, voice, api, voip, messaging, call, otp, verification, platform, cloud comms, developer tools, integration, auth, customer service, notifications, contact center, twilio icon - css.gg Icons - CgTwilio - SVG | WEBP | PNG | JPG - Icon free download
CgTwilio
twitter, brand, social, tweet, bird, microblog, social network, post, share, communication, x platform, follow, engagement, viral, social media, profile, feed, timeline, hashtags, community, marketing, promotion - css.gg Icons - CgTwitter - SVG | WEBP | PNG | JPG - Icon free download
CgTwitter
undo, reverse, back, step back, rollback, history, edit, action, revert, restore, previous, command, toolbar, shortcut, correction, mistake, design tools, workflow, ui action, interaction, navigation - css.gg Icons - CgUndo - SVG | WEBP | PNG | JPG - Icon free download
CgUndo
unsplash, brand, photo, image library, stock photos, gallery, media source, photography, creative assets, image provider, content creation, designer resources, api, photo download, visual content - css.gg Icons - CgUnsplash - SVG | WEBP | PNG | JPG - Icon free download
CgUnsplash
userlane, flow, journey, user path, workflow, process, steps, guided tour, onboarding, analytics, interaction flow, ux path, sequence, customer journey - css.gg Icons - CgUserlane - SVG | WEBP | PNG | JPG - Icon free download
CgUserlane
vercel, brand, deployment, hosting, serverless, nextjs, frontend, web app, build, deploy, cloud platform, developer tools, static hosting, jamstack, modern web - css.gg Icons - CgVercel - SVG | WEBP | PNG | JPG - Icon free download
CgVercel
view split, split view, dual pane, side by side, panel split, code editor, file compare, layout toggle, preview split, window split, ui layout, workflow, productivity, organize panels - css.gg Icons - CgViewSplit - SVG | WEBP | PNG | JPG - Icon free download
CgViewSplit
windows, microsoft, os, operating system, pc, desktop, brand, logo, win, software, system ui, platform, computer, tech brand, startup screen - css.gg Icons - CgWindows - SVG | WEBP | PNG | JPG - Icon free download
CgWindows
youtube, yt, video, streaming, brand, logo, play button, channel, creator, subscribe, social media, content, vlog, livestream, influencer, marketing, promotion - css.gg Icons - CgYoutube - SVG | WEBP | PNG | JPG - Icon free download
CgYoutube
apple, brand, logo, apple logo, mac, iphone, ipad, ios, macos, technology, apple inc, tech brand, computer, smartphone, device, hardware, premium brand, consumer tech, branding, store, app store, ecosystem, apple product, apple icon - Circum Icons - CiApple - SVG | WEBP | PNG | JPG - Icon free download
CiApple
cloud, storage, cloud icon, sync, backup, server, data, cloud storage, cloud computing, network, upload, download, connection, api, saas, hosting, infrastructure, web app, toolbar, button, nav, sidebar, system status, service - Circum Icons - CiCloud - SVG | WEBP | PNG | JPG - Icon free download
CiCloud
database, db, storage, server, data, dataset, warehouse, cloud db, backend, infrastructure, stack, query, sql, nosql, table, data center, admin, monitoring, analytics, system, devops, dashboard, schema, connection - Circum Icons - CiDatabase - SVG | WEBP | PNG | JPG - Icon free download
CiDatabase
export, share, send, upload, external, move out, data transfer, file export, download alt, action button, toolbar, ui control, workflow, integration, ios, android, material, fluent - Circum Icons - CiExport - SVG | WEBP | PNG | JPG - Icon free download
CiExport
facebook, brand, social media, meta, fb, share, like, social platform, network, community, communication, messaging, profile, page, social login, oauth, marketing, ios, android - Circum Icons - CiFacebook - SVG | WEBP | PNG | JPG - Icon free download
CiFacebook
hard drive, storage, disk, hdd, ssd, device, hardware, backup, memory, server, database, data, archive, external drive, internal drive, system storage, tech, computer, pc, drive icon, utility, file management, storage device, capacity, cloud sync, data center, infrastructure, ios, android - Circum Icons - CiHardDrive - SVG | WEBP | PNG | JPG - Icon free download
CiHardDrive
inbox in, email in, mail receive, incoming, receive, download to inbox, message box, folder in, workflow, tasks, incoming tasks, receive file, line inbox, minimal inbox, notification inbox - Circum Icons - CiInboxIn - SVG | WEBP | PNG | JPG - Icon free download
CiInboxIn
inbox out, email out, mail send, outgoing, send, upload from inbox, message box, folder out, tasks out, workflow, line inbox, minimal inbox, notification send, outbound queue - Circum Icons - CiInboxOut - SVG | WEBP | PNG | JPG - Icon free download
CiInboxOut
instagram, brand, social media, photo, camera, share, ig, stories, reels, profile, network, community, influencer, media post, social icon, logo, social button, mobile app, messaging, photography app, story sharing - Circum Icons - CiInstagram - SVG | WEBP | PNG | JPG - Icon free download
CiInstagram
keyboard, typing, keys, input device, hardware, computer, laptop, pc, mechanical keyboard, gaming keyboard, hotkeys, shortcut, command, editor, text input, programming, workflow, office, peripheral, device control - Circum Icons - CiKeyboard - SVG | WEBP | PNG | JPG - Icon free download
CiKeyboard
laptop, notebook, computer, pc, device, workstation, programming, coding, remote work, study, office, portable computer, screen, display, tech, hardware, electronics, workflow, online meeting, digital work - Circum Icons - CiLaptop - SVG | WEBP | PNG | JPG - Icon free download
CiLaptop
linkedin, brand, social media, professional network, career, resume, profile, business, company page, connect, job search, logo, social button, network, messaging, corporate, hr, recruiting, team, branding - Circum Icons - CiLinkedin - SVG | WEBP | PNG | JPG - Icon free download
CiLinkedin
redo, repeat, forward action, undo alternative, edit, history, reapply, arrow, curve arrow, action, toolbar, interaction, ui, workflow, command, shortcut, editing tool, revision, step forward - Circum Icons - CiRedo - SVG | WEBP | PNG | JPG - Icon free download
CiRedo
repeat, loop, cycle, replay, music repeat, video loop, media control, repeat icon, loop button, cycle arrows, playlist, continuous, iterate, rotation, circular arrows, workflow, automation, sequence - Circum Icons - CiRepeat - SVG | WEBP | PNG | JPG - Icon free download
CiRepeat
router, wifi, network device, internet, wireless, modem, connectivity, network hub, iot, broadband, lan, wan, signal, network management, gateway, infrastructure, server edge, tech ui, settings device - Circum Icons - CiRouter - SVG | WEBP | PNG | JPG - Icon free download
CiRouter
server, database, rack, hosting, backend, api, infrastructure, cloud server, dedicated host, network storage, devops, sysadmin, lan server, datacenter, deployment, compute, backend stack, tech tool, server ui - Circum Icons - CiServer - SVG | WEBP | PNG | JPG - Icon free download
CiServer
tag, shopping tag, price tag, label, pricing, sale, discount, promo, offer, retail tag, ecommerce, store, product label, catalog, brand, barcode, coupon, marketing, merchandise, storefront, product tag, price marker, item label, ios, android, outline tag - Circum Icons - CiShoppingTag - SVG | WEBP | PNG | JPG - Icon free download
CiShoppingTag
twitter, brand, social media, tweet, x, microblog, share, communication, community, network, promotion, marketing, social platform, social network, social icon, post, follow, profile, hashtag, timeline - Circum Icons - CiTwitter - SVG | WEBP | PNG | JPG - Icon free download
CiTwitter
view board, whiteboard, board, display, presentation, dashboard, analytics, screen, workspace, teaching, education, planning, ui panel, layout, diagram, workflow, organize, visual board - Circum Icons - CiViewBoard - SVG | WEBP | PNG | JPG - Icon free download
CiViewBoard
view timeline, timeline, progress, milestones, history, chronology, workflow, project timeline, events, task progression, gantt-like, planning, roadmap, schedule, sequence, time flow, ui component, storyline, tracking - Circum Icons - CiViewTimeline - SVG | WEBP | PNG | JPG - Icon free download
CiViewTimeline
youtube, brand, video, youtube logo, youtube icon, subscribe, channel, play, streaming, vlogger, content creator, youtuber, social media, embed, share, header, footer, link, cta, marketing, promotion, media, platform, playlist, live stream, video gallery, watch - Circum Icons - CiYoutube - SVG | WEBP | PNG | JPG - Icon free download
CiYoutube
android, brand, google, mobile, os, sdk, android logo, kotlin, java, android studio, adb, app, platform, developer, mobile development, play store, apk, device, support, tech stack, tooling, integration, documentation, badge, logo - Devicons - DiAndroid - SVG | WEBP | PNG | JPG - Icon free download
DiAndroid
angular, brand, framework, typescript, frontend, web, spa, ng, angular logo, components, cli, rxjs, module, single page, developer, tech stack, tutorial, project badge, ui framework, google, app, build, cdn, logo - Devicons - DiAngularSimple - SVG | WEBP | PNG | JPG - Icon free download
DiAngularSimple
atlassian, jira, confluence, bitbucket, project management, team collaboration, issue tracking, devops, scrum, agile, workflow, kanban, enterprise tools, cloud, team productivity, documentation, code hosting, ci cd - Devicons - DiAtlassian - SVG | WEBP | PNG | JPG - Icon free download
DiAtlassian
aws, amazon web services, cloud, cloud hosting, lambda, s3, ec2, rds, api gateway, iam, scaling, serverless, containers, cloud compute, vpc, infrastructure, cloud platform, storage, cdn, devops - Devicons - DiAws - SVG | WEBP | PNG | JPG - Icon free download
DiAws
bintray, package repository, artifact storage, jfrog, binary hosting, repository manager, software distribution, devops, package feed, artifact server, package cloud, deployment, cdn, build pipeline, hosting, download server, software releases, infrastructure, config, cli, sdk - Devicons - DiBintray - SVG | WEBP | PNG | JPG - Icon free download
DiBintray
bitbucket, git, repository, vcs, source control, atlassian, pull request, code hosting, devops, ci cd, team workflows, branching, merge, code review, project repo, developer tools, scrum, sprint, repository manager, software collaboration - Devicons - DiBitbucket - SVG | WEBP | PNG | JPG - Icon free download
DiBitbucket
brackets, code editor, adobe brackets, html editor, css editor, javascript editor, frontend coding, lightweight ide, developer tools, syntax highlighting, open source editor, web dev, project explorer, extensions, ui editor, real time preview, code workspace, editor environment - Devicons - DiBrackets - SVG | WEBP | PNG | JPG - Icon free download
DiBrackets
bugsense, error tracking, debugging, crash reports, app analytics, quality monitoring, bug tracker, mobile apps, diagnostics, exception logging, performance tracking, monitoring platform, developer tools, runtime errors, stack traces, application insights, alerting - Devicons - DiBugsense - SVG | WEBP | PNG | JPG - Icon free download
DiBugsense
chrome, google chrome, browser, web browser, browser testing, devtools, chrome extensions, internet, search engine, google brand, web performance, tabs, url bar, render engine, chromium, browsing, developer tools, user agent, web testing, cross browser - Devicons - DiChrome - SVG | WEBP | PNG | JPG - Icon free download
DiChrome
cisco, networking, router, switch, infrastructure, enterprise security, firewall, vpn, ios xe, telecom, datacenter, network tools, network admin, hardware brand, enterprise network, cloud connectivity, lan, wan, packet routing, infrastructure management - Devicons - DiCisco - SVG | WEBP | PNG | JPG - Icon free download
DiCisco
clojure, clojure logo, lisp, functional programming, fp, jvm, language, developer, programming, software, tech, backend stack, scripting, automation, engineering, tools, runtime, ecosystem - Devicons - DiClojure - SVG | WEBP | PNG | JPG - Icon free download
DiClojure
code badge, badge, label, tag, tech badge, code logo, developer tag, coding, programming, symbol, icon badge, ui badge, project badge, repository tag, devtools, workflow, developer identity - Devicons - DiCodeBadge - SVG | WEBP | PNG | JPG - Icon free download
DiCodeBadge
code, coding, programming, editor, ide, developer, tech, syntax, tools, development, software, workflow, env, coding tool, web development, script, frameworks, engineering - Devicons - DiCode - SVG | WEBP | PNG | JPG - Icon free download
DiCode
codeigniter, php framework, ci, mvc, backend, web framework, server, development, programming, app framework, lightweight framework, routing, php, tech stack, developer, software - Devicons - DiCodeigniter - SVG | WEBP | PNG | JPG - Icon free download
DiCodeigniter
coffeescript, coffee script, language, compiler, javascript preprocessor, scripting, frontend, developer, programming, syntax, web development, transpile, tooling, runtime, workflow, tech stack - Devicons - DiCoffeescript - SVG | WEBP | PNG | JPG - Icon free download
DiCoffeescript
compass, navigation, direction, tool, map, guide, orientation, devtools, workflow, web dev, ui icon, sidebar, menu, button, tooling, design system, reference, utility icon, framework, coding, layout, grid - Devicons - DiCompass - SVG | WEBP | PNG | JPG - Icon free download
DiCompass
composer, php, dependency manager, package manager, backend, devops, installation, library management, php tools, automation, terminal, cli, web dev, framework, build tools, versioning, project setup, coding utilities, developer tools, config - Devicons - DiComposer - SVG | WEBP | PNG | JPG - Icon free download
DiComposer
css3, css, frontend, stylesheet, design, layout, web dev, ui, theme, browser styling, grid, flexbox, animation, responsive, presentation, style sheet, web components, developer tools, html css - Devicons - DiCss3 - SVG | WEBP | PNG | JPG - Icon free download
DiCss3
cssdeck, sandbox, frontend, css editor, live editor, playground, testing, experiments, ui design, web dev, html css, prototyping, code share, snippet, interactive coding, developer tools, demo, layout testing, design experiments, browser tools - Devicons - DiCssdeck - SVG | WEBP | PNG | JPG - Icon free download
DiCssdeck
dart, google dart, programming language, flutter, mobile dev, app development, frontend, backend, strong typed, compiled, sdk, framework, cross platform, ui toolkit, developer tools, coding, syntax, performance, mobile apps - Devicons - DiDart - SVG | WEBP | PNG | JPG - Icon free download
DiDart
database, db, server, storage, sql, nosql, data store, backend, infrastructure, cloud, cluster, data management, query, schema, tables, devops, deployment, api backend, data pipeline, logging, monitoring - Devicons - DiDatabase - SVG | WEBP | PNG | JPG - Icon free download
DiDatabase
debian, linux, os, operating system, debian logo, debian brand, linux distro, gnu linux, server, infrastructure, sysadmin, terminal, bash, shell, devops, cloud, deployment, open source, package manager, apt, web servers, backend, hosting, vm, virtualization, developer tools, it ops, brand - Devicons - DiDebian - SVG | WEBP | PNG | JPG - Icon free download
DiDebian
digitalocean, do, cloud hosting, vps, droplets, kubernetes, containers, devops, server, infrastructure, cloud compute, cloud provider, scaling, deployment, hosting platform, developer platform, load balancer, spaces storage, cdn, api, dashboard, startup hosting, brand - Devicons - DiDigitalOcean - SVG | WEBP | PNG | JPG - Icon free download
DiDigitalOcean
django, python, django framework, backend, web framework, mtv, orm, api, server side, routing, templates, models, views, admin panel, full stack, development, backend tools, open source, authentication, rest, drf, scalable apps, brand - Devicons - DiDjango - SVG | WEBP | PNG | JPG - Icon free download
DiDjango
dlang, d language, programming language, system programming, compiled language, performance, backend, native apps, dlang logo, developer tools, compiler, memory management, cross platform, open source, runtime, modules, scripting, brand - Devicons - DiDlang - SVG | WEBP | PNG | JPG - Icon free download
DiDlang
docker, containers, docker logo, containerization, devops, kubernetes, images, registry, docker hub, cloud, infrastructure, deployment, scaling, orchestration, microservices, compose, swarm, virtualization, serverless, cicd, automation, developer tools, brand - Devicons - DiDocker - SVG | WEBP | PNG | JPG - Icon free download
DiDocker
doctrine, orm, php, database, doctrine orm, entity mapping, models, entities, queries, persistence, data layer, backend, framework, symfony, php ecosystem, sql, schema, migration, developer tools, open source, brand - Devicons - DiDoctrine - SVG | WEBP | PNG | JPG - Icon free download
DiDoctrine
dojo, dojo toolkit, javascript, js framework, frontend, ui toolkit, widgets, mvc, spa, web apps, modular js, amd, dojo logo, developer tools, ajax, dom, templating, animation, open source, brand - Devicons - DiDojo - SVG | WEBP | PNG | JPG - Icon free download
DiDojo
dotnet, .net, microsoft, framework, runtime, backend, aspnet, csharp, clr, developer platform, cross platform, web apps, api, microservices, enterprise apps, cloud, azure, compilation, open source, brand - Devicons - DiDotnet - SVG | WEBP | PNG | JPG - Icon free download
DiDotnet
dreamweaver, adobe dreamweaver, editor, web editor, html, css, frontend, design, web design, site builder, templates, layout, developer tools, adobe, creative cloud, wysiwyg, file management, publishing, brand - Devicons - DiDreamweaver - SVG | WEBP | PNG | JPG - Icon free download
DiDreamweaver
dropbox, cloud storage, file sync, file sharing, backup, collaboration, team folders, documents, cloud, storage service, drive, upload, download, workspace, productivity, remote work, sharing platform, security, brand - Devicons - DiDropbox - SVG | WEBP | PNG | JPG - Icon free download
DiDropbox
drupal, drupal cms, drupal logo, cms, content management, web platform, open source, php cms, website builder, framework, backend, frontend, web development, theme, module, plugin, site building, enterprise, developer tools, branding - Devicons - DiDrupal - SVG | WEBP | PNG | JPG - Icon free download
DiDrupal
eclipse, eclipse ide, java ide, developer tools, code editor, ide, programming, workspace, open source, dev environment, plugins, debug, refactor, compiler, productivity tool, software, java development, coding tool - Devicons - DiEclipse - SVG | WEBP | PNG | JPG - Icon free download
DiEclipse
ember, emberjs, javascript framework, frontend, spa, single page app, ui framework, routing, templating, mvc, web development, client side, open source, ember logo, modern web, component framework, developer tools - Devicons - DiEmber - SVG | WEBP | PNG | JPG - Icon free download
DiEmber
envato, envato logo, themeforest, codecanyon, marketplace, templates, assets, creative market, design resources, stock media, plugins, themes, digital products, brand, ecommerce, ui kits, graphics, developer tools - Devicons - DiEnvato - SVG | WEBP | PNG | JPG - Icon free download
DiEnvato
erlang, erlang logo, functional programming, fp, distributed systems, telecom, backend language, actor model, otp framework, high scalability, fault tolerant, concurrency, cluster, soft real time, server programming, beam vm, developer tools - Devicons - DiErlang - SVG | WEBP | PNG | JPG - Icon free download
DiErlang
extjs, sencha, javascript framework, enterprise ui, ui components, frontend framework, web apps, mvc framework, data grids, dashboard, enterprise development, widget library, spa, modern ui, developer tools, ext js logo - Devicons - DiExtjs - SVG | WEBP | PNG | JPG - Icon free download
DiExtjs
firefox, mozilla firefox, browser, web browser, mozilla, open source, internet, privacy browser, secure browsing, cross platform, developer tools, responsive design mode, fox logo, brand, software, surfing, web navigation - Devicons - DiFirefox - SVG | WEBP | PNG | JPG - Icon free download
DiFirefox
f#, fsharp, dotnet, functional programming, fp, ml style, microsoft, backend, strong typing, async, pattern matching, data modeling, compiler, cross platform, developer tools, fsharp logo - Devicons - DiFsharp - SVG | WEBP | PNG | JPG - Icon free download
DiFsharp
ghost, ghost cms, blog, blogging, publishing, markdown, cms platform, content platform, web app, brand, logo, developer tools, open source, platform, writing, editor, static site, theme, dashboard, website, frontend, backend - Devicons - DiGhost - SVG | WEBP | PNG | JPG - Icon free download
DiGhost
git, branch, git branch, version control, vcs, repository, source control, feature branch, workflow, merge, split, developer tools, devops, commit graph, code workflow, collaboration, github, gitlab, bitbucket - Devicons - DiGitBranch - SVG | WEBP | PNG | JPG - Icon free download
DiGitBranch
git, commit, git commit, vcs, version control, source control, checkpoint, save change, repository, developer tools, commit history, code workflow, github, gitlab, bitbucket, revision - Devicons - DiGitCommit - SVG | WEBP | PNG | JPG - Icon free download
DiGitCommit
git, compare, git compare, diff, file diff, code diff, changes, source control, version control, review, pull request, merge request, developer tools, repository, compare branches, review changes - Devicons - DiGitCompare - SVG | WEBP | PNG | JPG - Icon free download
DiGitCompare
git, merge, git merge, branch merge, version control, source control, repository, feature merge, workflow, developer tools, github, gitlab, bitbucket, merge conflict, pull request, integration - Devicons - DiGitMerge - SVG | WEBP | PNG | JPG - Icon free download
DiGitMerge
git, pull request, pr, merge request, review, code review, workflow, version control, repository, developer tools, github, gitlab, bitbucket, collaboration, branch, submit changes, approval - Devicons - DiGitPullRequest - SVG | WEBP | PNG | JPG - Icon free download
DiGitPullRequest
git, brand, git logo, version control, source control, repository, developer tools, vcs, github, gitlab, bitbucket, open source, code workflow, cli, branching, merging - Devicons - DiGit - SVG | WEBP | PNG | JPG - Icon free download
DiGit
github, github alt, brand, logo, octocat, source control, repository, vcs, developer community, open source, profile, organization, developer tools, code hosting, collaboration, issues, pull requests - Devicons - DiGithubAlt - SVG | WEBP | PNG | JPG - Icon free download
DiGithubAlt
github, github badge, badge, logo, brand, octocat, repository, open source, vcs, developer tools, profile badge, status badge, code hosting, collaboration, community - Devicons - DiGithubBadge - SVG | WEBP | PNG | JPG - Icon free download
DiGithubBadge
github, github full, brand, logo, full logo, octocat, repository, source control, vcs, developer tools, open source, community, code hosting, integration, profile - Devicons - DiGithubFull - SVG | WEBP | PNG | JPG - Icon free download
DiGithubFull
github, brand, repo, repository, git, version control, source code, code hosting, open source, developer, devops, ci cd, commit, push, pull request, merge, branch, issue tracker, collaboration, team, workflow, platform, hosting, web, cloud, integration, automation, api, cli, desktop app, organization, project, management, dashboard, toolbar, header, footer, nav, sidebar - Devicons - DiGithub - SVG | WEBP | PNG | JPG - Icon free download
DiGithub
gnu, brand, linux, open source, free software, fsf, operating system, os, toolchain, compiler, gcc, bash, shell, cli, kernel, unix, permissions, system administration, infrastructure, developer, package, environment, license, community, foundation, ecosystem, platform - Devicons - DiGnu - SVG | WEBP | PNG | JPG - Icon free download
DiGnu
go, golang, brand, programming language, backend, api, microservices, concurrency, goroutines, compiler, binary, cli, web server, framework, sdk, tooling, devops, cloud native, kubernetes, docker, fast, scalable, efficient, performant, developer, engineer, platform - Devicons - DiGo - SVG | WEBP | PNG | JPG - Icon free download
DiGo
google analytics, ga, analytics, tracking, metrics, data, dashboard, charts, conversion, traffic, events, behavior, funnels, audience, web analytics, measurement, performance, reports, marketing, seo, ppc, insights, optimisation, tracking code, tag manager, platform, brand - Devicons - DiGoogleAnalytics - SVG | WEBP | PNG | JPG - Icon free download
DiGoogleAnalytics
google drive, drive, cloud storage, file storage, documents, sheets, slides, collaboration, sharing, backup, sync, workspace, folders, upload, download, file manager, brand, cloud, productivity, team, organization, web app, office suite - Devicons - DiGoogleDrive - SVG | WEBP | PNG | JPG - Icon free download
DiGoogleDrive
google cloud, gcp, cloud platform, compute engine, kubernetes, gke, cloud run, cloud functions, bigquery, storage, vpc, iam, devops, infrastructure, scaling, networking, containers, serverless, deployment, automation, monitoring, observability, brand, platform, api, sdk - Devicons - DiGoogleCloudPlatform - SVG | WEBP | PNG | JPG - Icon free download
DiGoogleCloudPlatform
grails, groovy grails, framework, mvc, backend, web framework, rapid development, scaffolding, orm, gsp, grails app, plugin, api, crud, server, developer, enterprise, rest, tooling, build, project, platform, brand - Devicons - DiGrails - SVG | WEBP | PNG | JPG - Icon free download
DiGrails
groovy, language, scripting, jvm, java, gradle, grails, dsl, backend, automation, scripts, build tools, compiler, interpreter, developer, api, framework, rapid development, tooling, ecosystem, brand - Devicons - DiGroovy - SVG | WEBP | PNG | JPG - Icon free download
DiGroovy
grunt, task runner, automation, frontend, build, minify, uglify, compile, sass, less, bundle, workflow, cli, npm, scripts, developer, tooling, assets, optimization, project, brand - Devicons - DiGrunt - SVG | WEBP | PNG | JPG - Icon free download
DiGrunt
gulp, task runner, automation, pipeline, frontend, minify, uglify, sass, less, build, bundle, workflow, cli, npm, tooling, developer, assets, optimization, stream, project, brand - Devicons - DiGulp - SVG | WEBP | PNG | JPG - Icon free download
DiGulp
hackernews, hn, news, tech news, developer news, programming news, community, blog, discussion, feed, aggregator, open source, brand, logo, social platform, tech community, sidebar link, header link, navigation - Devicons - DiHackernews - SVG | WEBP | PNG | JPG - Icon free download
DiHackernews
haskell, functional programming, fp, lambda, code, backend, compiler, ghc, dev, programming language, logo, brand, syntax, developer tools, learning, academic, type system, server side, footer logo - Devicons - DiHaskell - SVG | WEBP | PNG | JPG - Icon free download
DiHaskell
heroku, cloud platform, paas, deployment, hosting, server, buildpacks, apps, scaling, devops, runtime, backend hosting, developer, brand, logo, cloud deploy, infrastructure, dashboard link - Devicons - DiHeroku - SVG | WEBP | PNG | JPG - Icon free download
DiHeroku
html5, 3d, 3d effects, webgl, css effects, frontend, browser, animation, graphics, visual effects, ui, web design, developer, brand, logo, interactive, multimedia, renderer - Devicons - DiHtml53dEffects - SVG | WEBP | PNG | JPG - Icon free download
DiHtml53dEffects
html5, connectivity, network, websocket, api, frontend, browser, communication, offline mode, service worker, dev, developer tools, logo, brand, web apps, modern web, pwa - Devicons - DiHtml5Connectivity - SVG | WEBP | PNG | JPG - Icon free download
DiHtml5Connectivity
html5, device access, camera, microphone, sensors, browser api, web platform, permissions, user media, frontend, developer, brand, logo, hardware access, mobile web, pwa - Devicons - DiHtml5DeviceAccess - SVG | WEBP | PNG | JPG - Icon free download
DiHtml5DeviceAccess
html5, multimedia, audio, video, media api, streaming, player, frontend, browser tech, web apps, dev, developer tools, logo, brand, interactive, content - Devicons - DiHtml5Multimedia - SVG | WEBP | PNG | JPG - Icon free download
DiHtml5Multimedia
html5, html, frontend, css, javascript, browser, markup, web standard, web design, developer, brand, logo, ui, framework, pwa, modern web, responsive, layout - Devicons - DiHtml5 - SVG | WEBP | PNG | JPG - Icon free download
DiHtml5
ie, internet explorer, browser, legacy browser, microsoft, web, frontend, compatibility, legacy support, developer, brand, logo, old browser, edge transition, testing - Devicons - DiIe - SVG | WEBP | PNG | JPG - Icon free download
DiIe
illustrator, adobe illustrator, vector, graphics, design, logo, brand, ai file, drawing, editing, illustration, creative cloud, designer tools, digital art, icon design, mockups, ui assets - Devicons - DiIllustrator - SVG | WEBP | PNG | JPG - Icon free download
DiIllustrator
intellij, jetbrains, intellij idea, ide, code editor, java ide, developer tool, programming, coding, backend, frontend, workspace, editor, syntax, project, refactor, debug, android, android development, enterprise, build tool, code intelligence, productivity, software, dev environment, developer workflow, devops - Devicons - DiIntellij - SVG | WEBP | PNG | JPG - Icon free download
DiIntellij
java, programming language, backend, oop, object oriented, jvm, jdk, jre, enterprise apps, spring, hibernate, microservices, server, api, android, compiler, runtime, software engineering, cloud apps, enterprise stack, devops, tooling, syntax, strong typed - Devicons - DiJava - SVG | WEBP | PNG | JPG - Icon free download
DiJava
jenkins, ci, cd, continuous integration, continuous delivery, automation, pipeline, devops, build server, deploy, testing, workflow, orchestration, infrastructure, plugins, scripts, jobs, automation server, software delivery, enterprise, team workflow, quality assurance - Devicons - DiJenkins - SVG | WEBP | PNG | JPG - Icon free download
DiJenkins
jira, atlassian, project management, scrum, agile, kanban, tickets, issues, backlog, sprint, workflow, devops, collaboration, team board, product planning, task tracking, work items, epic, story, bug tracking, enterprise, productivity, dashboard - Devicons - DiJira - SVG | WEBP | PNG | JPG - Icon free download
DiJira
jquery, jquery ui, jqueryui, jquery ui logo, javascript library, ui toolkit, frontend, widgets, interactions, draggable, sortable, tabs, accordion, dialog, web components, ui components, web design, frontend dev, developer tools, ecosystem, brand - Devicons - DiJqueryUiLogo - SVG | WEBP | PNG | JPG - Icon free download
DiJqueryUiLogo
js, javascript, javascript badge, js logo, badge, language badge, frontend, ecmascript, coding, webdev, node, browser scripting, programming language, dev badge, tech stack, brand - Devicons - DiJsBadge - SVG | WEBP | PNG | JPG - Icon free download
DiJsBadge
komodo, komodo ide, komodo edit, ide, code editor, editor, programming tools, software, developer tools, workflow, debugging, coding environment, brand, tech stack, utilities - Devicons - DiKomodo - SVG | WEBP | PNG | JPG - Icon free download
DiKomodo
krakenjs, krakenjs badge, kraken, express extension, javascript framework, node framework, backend, server framework, api, middleware, badge, brand, tech logo, webdev, nodejs ecosystem - Devicons - DiKrakenjsBadge - SVG | WEBP | PNG | JPG - Icon free download
DiKrakenjsBadge
krakenjs, kraken, javascript framework, node framework, backend, api framework, server routing, middleware, webdev, nodejs, ecosystem, brand, tech - Devicons - DiKrakenjs - SVG | WEBP | PNG | JPG - Icon free download
DiKrakenjs
laravel, php framework, mvc, eloquent, artisan, blade, php, backend, web framework, server side, routing, api, orm, dev stack, brand, ecosystem - Devicons - DiLaravel - SVG | WEBP | PNG | JPG - Icon free download
DiLaravel
less, lesscss, css preprocessor, preprocessor, stylesheets, variables, mixins, frontend, styling, web design, theming, css tooling, developer tools, brand - Devicons - DiLess - SVG | WEBP | PNG | JPG - Icon free download
DiLess
linux, tux, os, operating system, kernel, open source, unix, terminal, cli, server, sysadmin, devops, infrastructure, containers, vm, brand - Devicons - DiLinux - SVG | WEBP | PNG | JPG - Icon free download
DiLinux
magento, adobe commerce, ecommerce, storefront, online store, cms, catalog, cart, checkout, payment, extension, plugin, php platform, merchant tools, brand, ecommerce platform - Devicons - DiMagento - SVG | WEBP | PNG | JPG - Icon free download
DiMagento
mailchimp, email marketing, automation, campaigns, newsletter, crm, audience management, segmentation, email tools, brand, chimp logo, marketing platform, customer engagement, templates, analytics - Devicons - DiMailchimp - SVG | WEBP | PNG | JPG - Icon free download
DiMailchimp
markdown, md, markup, text, documentation, docs, readme, static content, syntax, writer, editor, developer, github, gitlab, blog, notes, content tools, open source, developer tools, code - Devicons - DiMarkdown - SVG | WEBP | PNG | JPG - Icon free download
DiMarkdown
meteor, javascript, meteorjs, framework, fullstack, realtime, cloud app, developer tools, web app, bundler, api, node integration, package manager, open source, build tool - Devicons - DiMeteor - SVG | WEBP | PNG | JPG - Icon free download
DiMeteor
modernizr, feature detection, browser support, testing, frontend, javascript, developer tools, html5, css3, compatibility, runtime check, progressive enhancement, fallback, polyfill, web app - Devicons - DiModernizr - SVG | WEBP | PNG | JPG - Icon free download
DiModernizr
mootools, mootools badge, javascript library, framework, effects, dom manipulation, frontend, ui toolkit, legacy js, developer tools, web scripts, open source, widget, badge icon - Devicons - DiMootoolsBadge - SVG | WEBP | PNG | JPG - Icon free download
DiMootoolsBadge
mootools, javascript, framework, dom, frontend, ui toolkit, effects, animation script, open source, legacy web, developer tools, scripting, browser, widgets - Devicons - DiMootools - SVG | WEBP | PNG | JPG - Icon free download
DiMootools
mssql, sql server, database, microsoft sql, relational db, rdbms, enterprise db, backend, data storage, server, data platform, sql, ado, orm, dotnet, cloud, enterprise apps, dashboard, devops, db admin, etl, data warehouse, analytics - Devicons - DiMsqlServer - SVG | WEBP | PNG | JPG - Icon free download
DiMsqlServer
netbeans, ide, java ide, editor, developer tools, code editor, open source ide, project management, debugger, compiler, java development, plugins, workspace, coding, productivity, desktop ide - Devicons - DiNetbeans - SVG | WEBP | PNG | JPG - Icon free download
DiNetbeans
nginx, web server, reverse proxy, load balancer, http server, ssl, performance, high availability, backend, cloud, devops, proxy server, routing, https, server config, deployment, gateway - Devicons - DiNginx - SVG | WEBP | PNG | JPG - Icon free download
DiNginx
nodejs, node, javascript runtime, backend, server side, api, express, npm, js, microservices, event loop, async, open source, runtime, developer tools, cli, full stack, web server - Devicons - DiNodejsSmall - SVG | WEBP | PNG | JPG - Icon free download
DiNodejsSmall
npm, node package manager, package manager, javascript, node, dependencies, packages, modules, cli, developer tools, install, update, versioning, workflow, build tools, ecosystem, open source - Devicons - DiNpm - SVG | WEBP | PNG | JPG - Icon free download
DiNpm
openshift, open shift, red hat, cloud platform, kubernetes, containers, paas, devops, orchestration, cluster, infrastructure, automation, deployment, ci cd, enterprise cloud, server management, developer tools, backend, microservices, hosting, cluster ops, platform engineering, branding, logo - Devicons - DiOpenshift - SVG | WEBP | PNG | JPG - Icon free download
DiOpenshift
open source, opensource, oss, community, free software, collaboration, git, version control, packages, libraries, frameworks, developer tools, coding, repository, contribute, license, github, projects, dev community, branding, logo - Devicons - DiOpensource - SVG | WEBP | PNG | JPG - Icon free download
DiOpensource
opera, browser, web browser, internet, navigation, web access, tabs, search, ui, mobile browser, desktop browser, software, developer tools, testing, cross browser, compatibility, performance, network, branding, logo - Devicons - DiOpera - SVG | WEBP | PNG | JPG - Icon free download
DiOpera
perl, programming, script, scripting, backend, cli, automation, text processing, regex, developer tools, languages, unix, linux, server scripts, system tasks, legacy systems, coding, opensource, branding, logo - Devicons - DiPerl - SVG | WEBP | PNG | JPG - Icon free download
DiPerl
phonegap, cordova, hybrid apps, mobile apps, cross platform, javascript apps, framework, app builder, mobile development, ui, android, ios, frontend, backend, plugins, deployment, developer tools, branding, logo - Devicons - DiPhonegap - SVG | WEBP | PNG | JPG - Icon free download
DiPhonegap
photoshop, ps, adobe, image editing, photo editing, graphic design, layers, retouch, ui design, mockups, digital art, illustration, composition, filters, color correction, creative tools, designer workflow, branding, logo - Devicons - DiPhotoshop - SVG | WEBP | PNG | JPG - Icon free download
DiPhotoshop
php, backend, server side, web development, programming, scripting, lamp stack, mysql, apache, cms, wordpress, joomla, drupal, framework, laravel, symfony, developer tools, backend engineering, opensource, branding, logo - Devicons - DiPhp - SVG | WEBP | PNG | JPG - Icon free download
DiPhp
postgresql, postgres, database, db, sql, rdbms, open source, structured data, backend, queries, developer tools, data storage, indexing, transactions, scalability, server, analytics, data ops, infrastructure, branding, logo - Devicons - DiPostgresql - SVG | WEBP | PNG | JPG - Icon free download
DiPostgresql
prolog, logic programming, ai, inference engine, rules engine, research, academic, backend, knowledge base, constraints, developer tools, languages, symbolic ai, automation, data modeling, opensource, branding, logo - Devicons - DiProlog - SVG | WEBP | PNG | JPG - Icon free download
DiProlog
python, programming, backend, scripting, automation, data science, machine learning, ai, deep learning, pandas, django, flask, fastapi, developer tools, analysis, ml ops, cli, frontend backend, opensource, branding, logo - Devicons - DiPython - SVG | WEBP | PNG | JPG - Icon free download
DiPython
rackspace, cloud, hosting, server provider, devops, infrastructure, saas, iaas, managed hosting, deployment, platform, backend, sysadmin, cluster, scalable hosting, service provider, linux hosting, enterprise cloud, datacenter, ops, automation, api, web hosting, backend services, hosting dashboard - Devicons - DiRackspace - SVG | WEBP | PNG | JPG - Icon free download
DiRackspace
react, reactjs, react.js, javascript, frontend, ui library, components, hooks, jsx, spa, framework, client side, web development, ui toolkit, virtual dom, state management, frontend dev, ui design, modern web, component based, design system, developer tools, react ecosystem, web apps - Devicons - DiReact - SVG | WEBP | PNG | JPG - Icon free download
DiReact
red hat, redhat, rhel, linux, enterprise linux, open source, server os, rpm, sysadmin, devops, cloud, virtualization, security, infrastructure, enterprise, os distribution, containerization, kubernetes ecosystem, fedora related, linux server, it ops, deployment, data center, admin tools - Devicons - DiRedhat - SVG | WEBP | PNG | JPG - Icon free download
DiRedhat
redis, cache, in-memory database, nosql, kv store, key value, pubsub, realtime, queue, backend, session store, database engine, high performance, distributed cache, scaling, cluster, persistence, storage, devops, server side, cloud services, stream, task queue, message broker - Devicons - DiRedis - SVG | WEBP | PNG | JPG - Icon free download
DiRedis
ruby, ruby rough, ruby language, scripting, backend, dynamic language, rails ecosystem, gem, package manager, developer tools, programming, cli tools, backend logic, oop, server side, ruby dev, syntax, open source, automation, task runner, ruby gems, ecosystem, script engine - Devicons - DiRubyRough - SVG | WEBP | PNG | JPG - Icon free download
DiRubyRough
ruby, ruby language, ruby logo, programming, backend, scripting, rails, ruby on rails, ror, compiler, interpreter, oop, backend dev, api, webdev, server side, developer tool, code, software, framework, icon, brand - Devicons - DiRuby - SVG | WEBP | PNG | JPG - Icon free download
DiRuby
rust, rust logo, rust lang, systems programming, memory safety, low level, backend, compiler, cargo, rustc, fast code, safe code, multithreading, concurrency, cli tools, webassembly, wasm, performance, developer tool, brand - Devicons - DiRust - SVG | WEBP | PNG | JPG - Icon free download
DiRust
safari, safari browser, apple browser, web browser, macos, ios, explorer, navigation, internet, web app, ui, ux, mobile, desktop, cross platform, web navigation, browser icon, bookmark, tab, brand - Devicons - DiSafari - SVG | WEBP | PNG | JPG - Icon free download
DiSafari
sass, scss, sass logo, css preprocessor, frontend, styling, design, theming, variables, mixins, ui design, webdev, compiler, style sheet, styling engine, css enhancement, brand, developer tool, component styling - Devicons - DiSass - SVG | WEBP | PNG | JPG - Icon free download
DiSass
scala, scala language, scala logo, functional programming, fp, oop, jvm, java interoperability, backend, akka, spark, big data, distributed systems, api dev, developer tool, typed language, code, software engineering, brand - Devicons - DiScala - SVG | WEBP | PNG | JPG - Icon free download
DiScala
scriptcs, c sharp scripting, c# scripting, script cs logo, dotnet scripting, csharp, scripting engine, runtime, cli, automation, dev tools, quick scripts, prototype code, dotnet, coding, compiler, interpreter, brand - Devicons - DiScriptcs - SVG | WEBP | PNG | JPG - Icon free download
DiScriptcs
scrum, scrum logo, agile, project management, sprint, kanban, team workflow, collaboration, planning, standup, backlog, retrospective, product owner, scrum master, development process, workflow tool, brand - Devicons - DiScrum - SVG | WEBP | PNG | JPG - Icon free download
DiScrum
sencha touch, sencha, touch ui, mobile ui, javascript framework, frontend, hybrid apps, ux, design system, components, cordova, phonegap, enterprise apps, developer tool, brand, ui toolkit, mobile dev - Devicons - DiSenchatouch - SVG | WEBP | PNG | JPG - Icon free download
DiSenchatouch
sizzle, sizzle js, selector engine, javascript, dom engine, jquery core, query selector, frontend, webdev, js library, dom parsing, developer tool, performance, selectors, utility library, brand - Devicons - DiSizzlejs - SVG | WEBP | PNG | JPG - Icon free download
DiSizzlejs
smashing magazine, smashingmag, design magazine, web design, frontend, development blog, ui ux, articles, tutorials, learning, education, news, resources, creative, developer resource, brand - Devicons - DiSmashingMagazine - SVG | WEBP | PNG | JPG - Icon free download
DiSmashingMagazine
spark, apache spark, big data, data processing, cluster, hadoop, etl, data pipeline, analytics, machine learning, data engine, developer tool, backend, server processing, distributed computing, python spark, scala spark, data science, workflow, high performance - Devicons - DiSpark - SVG | WEBP | PNG | JPG - Icon free download
DiSpark
techcrunch, brand, logo, news site, tech media, startup news, technology blog, magazine, press, publication, editorial, website logo, media brand, news platform, tech journalism, header logo, footer logo, sidebar logo, navigation, brand icon - Devicons - DiTechcrunch - SVG | WEBP | PNG | JPG - Icon free download
DiTechcrunch
terminal, badge, shell, cli, command line, console, prompt, developer tools, coding, programming, script, automation, devops, sysadmin, build tools, compile, run command, debug, linux tools, macos terminal, windows terminal, developer badge, status badge, deployment - Devicons - DiTerminalBadge - SVG | WEBP | PNG | JPG - Icon free download
DiTerminalBadge
terminal, shell, cli, command line, console, prompt, devtools, developer tools, coding, programming, script, automation, run, execute, debug, build, compile, sysadmin, infrastructure, linux, macos, windows terminal, command prompt, developer environment - Devicons - DiTerminal - SVG | WEBP | PNG | JPG - Icon free download
DiTerminal
travis, travis ci, brand, logo, ci, cd, continuous integration, continuous delivery, pipeline, automation, build, test, deploy, devops, developer tools, workflow, infrastructure, service logo, cloud workflow, github actions alternative - Devicons - DiTravis - SVG | WEBP | PNG | JPG - Icon free download
DiTravis
trello, brand, logo, kanban, board, task, task management, project management, collaboration, workflow, productivity, team work, cards, lists, scrum, agile, planning, tracker, tool logo, dashboard - Devicons - DiTrello - SVG | WEBP | PNG | JPG - Icon free download
DiTrello
typo3, brand, logo, cms, content management, website, web platform, php cms, enterprise cms, publishing, editorial, web development, backend, frontend, framework, template system, web builder, content editing, organization - Devicons - DiTypo3 - SVG | WEBP | PNG | JPG - Icon free download
DiTypo3
ubuntu, linux, linux distro, os, operating system, brand, logo, open source, developer environment, server, infrastructure, terminal, devops, sysadmin, cloud, vm, desktop environment, canonical, package manager, bash - Devicons - DiUbuntu - SVG | WEBP | PNG | JPG - Icon free download
DiUbuntu
uikit, ui kit, brand, logo, framework, frontend, components, css framework, web design, ui library, responsive design, theme, interface elements, component system, design system, layout tools, developer tools, web toolkit - Devicons - DiUikit - SVG | WEBP | PNG | JPG - Icon free download
DiUikit
unity, unity small, brand, logo, game engine, gaming, 3d, developer tools, game dev, asset creation, rendering, animation, vr, ar, mobile games, desktop games, engine logo, workflow, editor, design tools - Devicons - DiUnitySmall - SVG | WEBP | PNG | JPG - Icon free download
DiUnitySmall
vim, brand, logo, editor, text editor, developer tools, terminal editor, cli editor, neovim, coding, programming, open source, keyboard driven, efficiency, modal editing, linux, macos, windows, developer workflow - Devicons - DiVim - SVG | WEBP | PNG | JPG - Icon free download
DiVim
yahoo, yahoo small, brand, search engine, email provider, ymail, portal, news, finance, messenger, legacy web, service platform, internet brand, landing header, footer icon - Devicons - DiYahooSmall - SVG | WEBP | PNG | JPG - Icon free download
DiYahooSmall
yeoman, yo, scaffolder, generator, project template, cli, tool, bootstrap project, starter kit, frontend, backend, workflow, automation tool, dev experience, code generation - Devicons - DiYeoman - SVG | WEBP | PNG | JPG - Icon free download
DiYeoman
500px, photo platform, photography, photo sharing, portfolio, creative community, brand, logo, social media, camera, gallery, images, visual art, photographer, nav, footer logo, header logo, button, icon pack - Font Awesome 5 - Fa500Px - SVG | WEBP | PNG | JPG - Icon free download
Fa500Px
accusoft, brand, logo, software, enterprise, ocr, document processing, pdf, cloud tools, api, developer tools, conversion, digital workflow, automation, tech, saas, vendor - Font Awesome 5 - FaAccusoft - SVG | WEBP | PNG | JPG - Icon free download
FaAccusoft
acquisitions incorporated, ai, dnd, dungeons and dragons, tabletop, rpg, gaming, fantasy, brand, logo, podcast, livestream, community, adventure, entertainment, geek culture - Font Awesome 5 - FaAcquisitionsIncorporated - SVG | WEBP | PNG | JPG - Icon free download
FaAcquisitionsIncorporated
adn, app dot net, social network, microblogging, communication, brand, logo, messaging, timeline, community, developer platform, api, social media, tech - Font Awesome 5 - FaAdn - SVG | WEBP | PNG | JPG - Icon free download
FaAdn
adversal, ad network, advertising, marketing, brand, logo, adtech, publisher, monetization, traffic, campaigns, display ads, programmatic, media, digital marketing - Font Awesome 5 - FaAdversal - SVG | WEBP | PNG | JPG - Icon free download
FaAdversal
affiliatetheme, affiliate, theme, wordpress, ecommerce, blogging, affiliate marketing, brand, logo, monetization, seo, publisher, content marketing, affiliate tools, ads, conversion - Font Awesome 5 - FaAffiliatetheme - SVG | WEBP | PNG | JPG - Icon free download
FaAffiliatetheme
airbnb, lodging, stay, travel, rental, vacation home, host, booking, brand, logo, hospitality, bnb, accommodation, property, guest, tourism, platform - Font Awesome 5 - FaAirbnb - SVG | WEBP | PNG | JPG - Icon free download
FaAirbnb
algolia, search, search engine, api, developer, brand, logo, saas, cloud search, instant search, query, indexing, site search, autocomplete, tech, frontend - Font Awesome 5 - FaAlgolia - SVG | WEBP | PNG | JPG - Icon free download
FaAlgolia
alipay, payment, wallet, china, alibaba, pay, brand, logo, ecommerce, checkout, qr pay, finance, transactions, mobile payment, digital wallet, billing, secure pay - Font Awesome 5 - FaAlipay - SVG | WEBP | PNG | JPG - Icon free download
FaAlipay
amazon pay, amazon, pay, payment, checkout, wallet, billing, online payment, ecommerce, transaction, upi, credit card, debit card, gateway, amazon wallet, shopping, pay online, brand, logo, button, header, footer, navbar, cta, digital wallet, merchant - Font Awesome 5 - FaAmazonPay - SVG | WEBP | PNG | JPG - Icon free download
FaAmazonPay
amazon, shopping, ecommerce, marketplace, amazon logo, brand, store, online store, prime, retail, cart, search, product, buy, sell, delivery, logo, navbar, footer, menu, cta, brand mark, global brand - Font Awesome 5 - FaAmazon - SVG | WEBP | PNG | JPG - Icon free download
FaAmazon
amilia, brand, logo, community, network, platform, startup, social, collaboration, team, group, identity, social platform, navbar, header, footer, menu icon - Font Awesome 5 - FaAmilia - SVG | WEBP | PNG | JPG - Icon free download
FaAmilia
android, google android, robot, os, mobile, smartphone, app, apk, development, android developer, play store, material, logo, brand, platform, device, software, tech, ui, widget, navbar, footer, badge - Font Awesome 5 - FaAndroid - SVG | WEBP | PNG | JPG - Icon free download
FaAndroid
angellist, angel list, startup, investor, funding, venture capital, vc, business, founder, entrepreneur, network, social platform, logo, brand, jobs, recruit, hire, team, company profile, navbar, footer, share - Font Awesome 5 - FaAngellist - SVG | WEBP | PNG | JPG - Icon free download
FaAngellist
angry creative, agency, design, creative, studio, branding, web agency, logo, brand, wordpress, development, marketing, identity, graphics, team, portfolio, navbar, footer - Font Awesome 5 - FaAngrycreative - SVG | WEBP | PNG | JPG - Icon free download
FaAngrycreative
angular, angularjs, framework, frontend, typescript, web development, spa, javascript, developer, coding, ui framework, material, logo, brand, tech, programming, webpack, router, component, cli - Font Awesome 5 - FaAngular - SVG | WEBP | PNG | JPG - Icon free download
FaAngular
app store ios, apple, ios, download, install, mobile app, iphone, ipad, store badge, application, apple store, device, software, brand, logo, cta, button, header, landing page - Font Awesome 5 - FaAppStoreIos - SVG | WEBP | PNG | JPG - Icon free download
FaAppStoreIos
app store, store, app marketplace, download, install, mobile, ios, mac, apple, software, brand, logo, application, cta button, badge, store link, navbar, footer - Font Awesome 5 - FaAppStore - SVG | WEBP | PNG | JPG - Icon free download
FaAppStore
apper, app platform, brand, logo, mobile, technology, startup, dev tool, app builder, software, ui, team, navbar, footer, badge, identity, platform - Font Awesome 5 - FaApper - SVG | WEBP | PNG | JPG - Icon free download
FaApper
apple, brand, logo, mac, macbook, iphone, ipad, ios, macos, tech company, technology, electronics, hardware, software, branding, mobile, desktop, store, ecosystem, iconic logo, button, badge - Font Awesome 5 - FaApple - SVG | WEBP | PNG | JPG - Icon free download
FaApple
asymmetrik, brand, tech company, enterprise, data, analytics, security, software, solutions, development, branding, logo, platform, api, integration, business, professional services, badge, button - Font Awesome 5 - FaAsymmetrik - SVG | WEBP | PNG | JPG - Icon free download
FaAsymmetrik
atlassian, jira, confluence, bitbucket, trello, collaboration, productivity, project management, devops, software development, workflow, teamwork, branding, enterprise, saas, tools, platform, organization, badge, logo - Font Awesome 5 - FaAtlassian - SVG | WEBP | PNG | JPG - Icon free download
FaAtlassian
autoprefixer, css, frontend, tool, postcss, web development, browser prefixes, automation, style processing, build tools, developer tool, branding, workflow, code, compiler, badge, button - Font Awesome 5 - FaAutoprefixer - SVG | WEBP | PNG | JPG - Icon free download
FaAutoprefixer
avianex, airline, flight, air travel, aviation, booking, airport, travel, transportation, brand, logo, ticketing, journey, trip, flight service, badge, button - Font Awesome 5 - FaAvianex - SVG | WEBP | PNG | JPG - Icon free download
FaAvianex
aviato, brand, startup, tech company, fictional brand, marketing, logo, business, platform, community, identity, badge, symbol, button - Font Awesome 5 - FaAviato - SVG | WEBP | PNG | JPG - Icon free download
FaAviato
aws, amazon web services, cloud, hosting, server, infrastructure, lambda, s3, ec2, rds, dynamodb, api, devops, scaling, deployment, cloud computing, backend, platform, saas, enterprise, badge, logo - Font Awesome 5 - FaAws - SVG | WEBP | PNG | JPG - Icon free download
FaAws
bandcamp, brand, music, audio, streaming, artist platform, indie music, album, song, playlist, media, entertainment, publisher, creative, upload, share, digital store, badge, logo, icon, web, app, social media - Font Awesome 5 - FaBandcamp - SVG | WEBP | PNG | JPG - Icon free download
FaBandcamp
battlenet, brand, gaming, blizzard, game launcher, account, multiplayer, esports, pc gaming, launcher, profile, login, online play, friends, network, badge, logo, blizzard app, authentication, gamer community - Font Awesome 5 - FaBattleNet - SVG | WEBP | PNG | JPG - Icon free download
FaBattleNet
behance, behance square, brand, design, portfolio, creative work, designer, ui, ux, case study, project showcase, art, illustration, graphic design, badge, logo, social platform, dribbble alternative, profile, square icon - Font Awesome 5 - FaBehanceSquare - SVG | WEBP | PNG | JPG - Icon free download
FaBehanceSquare
behance, brand, design, portfolio, creative, graphic design, ui, ux, illustration, case study, project, profile, dribbble alt, designer hub, logo, badge, social link, creative showcase, artwork - Font Awesome 5 - FaBehance - SVG | WEBP | PNG | JPG - Icon free download
FaBehance
bimobject, brand, architecture, construction, engineering, bim, 3d models, cad, planning, building, assets, specification, product libraries, architect tools, interior design, logo, badge, platform - Font Awesome 5 - FaBimobject - SVG | WEBP | PNG | JPG - Icon free download
FaBimobject
bitbucket, brand, git, repo, repository, atlassian, version control, code hosting, devops, pull request, developer, team collaboration, ci cd, pipeline, source control, project, badge, logo, integration, vcs - Font Awesome 5 - FaBitbucket - SVG | WEBP | PNG | JPG - Icon free download
FaBitbucket
bitcoin, btc, crypto, cryptocurrency, brand, coin, token, blockchain, wallet, exchange, mining, trading, payment, digital currency, market, invest, finance, ledger, defi, logo, badge - Font Awesome 5 - FaBitcoin - SVG | WEBP | PNG | JPG - Icon free download
FaBitcoin
bity, brand, social, media, platform, profile, logo, badge, communication, messaging, creator, community, content, digital, network, web, app - Font Awesome 5 - FaBity - SVG | WEBP | PNG | JPG - Icon free download
FaBity
black tie, brand, formal, tuxedo, bowtie, fashion, style, luxury, event, dress code, elegant, attire, accessory, logo, badge, premium, gala, suit, menswear - Font Awesome 5 - FaBlackTie - SVG | WEBP | PNG | JPG - Icon free download
FaBlackTie
blackberry, brand, mobile, phone, device, enterprise, security, messaging, bbm, smartphone, corporate, platform, logo, badge, communication, email, business phone, legacy device, tech - Font Awesome 5 - FaBlackberry - SVG | WEBP | PNG | JPG - Icon free download
FaBlackberry
Tags
brandlogosocialworkflowbackenddevopsdeveloper toolsplatforminfrastructureuideveloperfrontendcommunityserverwebsharebadgecloudautomationsoftwaredesignmediachatnetworkopen sourceapistorageframeworkcodeprofileeditortechcollaborationdatabasegooglecommunicationandroidprogrammingbrandingcirclebuttoncliiosbrowserhostingdeploymentclusterrepositorycodingsquaremessagingoutlinefilemarketinghardwarevideoofficesqlinternetecommercetoolsearchmicrosoftenterpriseappgittoolbarnosqlosteamcompilerpropertydatastoreportfoliobuildgaminggithubnavigationcontentdevicecitybuildingdashboardproductivitymobiledownloadprojectrepoaudiotasksocial mediadevelopmentdocumentopspaymentchinastreamingsettingscisymboldevaimessagemusiccreativecdjavascriptactionvcsworkspacesystemfilledorganizationsyntaxecosystemversion controlsource control