CRUDIOS

fa/FaBlackberry (Font Awesome 5)

VS Code
1import { FaBlackberry } from "react-icons/fa";
2
3export default function Page(){
4  return <div><FaBlackberry/></div>
5}
Click To Copy (Free To Use)
Description
BlackBerry brand icon representing enterprise mobile devices, secure communication platforms, and corporate tech ecosystems, commonly used in device listings, legacy support pages, business profiles, and technology branding sections.
Related Icons
alipay, payment, wallet, finance, brand, transaction, china - Ant Design Icons - AiFillAlipayCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillAlipayCircle
alipay, square, brand, wallet, payment, china, logo - Ant Design Icons - AiFillAlipaySquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillAlipaySquare
aliwangwang, chat, im, messaging, brand, alibaba - Ant Design Icons - AiFillAliwangwang - SVG | WEBP | PNG | JPG - Icon free download
AiFillAliwangwang
amazon, circle, brand, store, ecommerce, logo, retail - Ant Design Icons - AiFillAmazonCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillAmazonCircle
amazon, square, brand, store, ecommerce, retail, logo - Ant Design Icons - AiFillAmazonSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillAmazonSquare
android, robot, os, mobile, brand, google, logo - Ant Design Icons - AiFillAndroid - SVG | WEBP | PNG | JPG - Icon free download
AiFillAndroid
apple, brand, ios, mac, logo, technology, store - Ant Design Icons - AiFillApple - SVG | WEBP | PNG | JPG - Icon free download
AiFillApple
appstore, apps, store, download, apple, mobile, brand - Ant Design Icons - AiFillAppstore - SVG | WEBP | PNG | JPG - Icon free download
AiFillAppstore
behance, brand, circle, logo, social, design, portfolio - Ant Design Icons - AiFillBehanceCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillBehanceCircle
behance, brand, square, logo, design, portfolio, social - Ant Design Icons - AiFillBehanceSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillBehanceSquare
bilibili, brand, logo, video, anime, streaming, social - Ant Design Icons - AiFillBilibili - SVG | WEBP | PNG | JPG - Icon free download
AiFillBilibili
chrome, browser, google, web, brand, logo, internet - Ant Design Icons - AiFillChrome - SVG | WEBP | PNG | JPG - Icon free download
AiFillChrome
codesandbox, circle, sandbox, code, dev, tool, brand - Ant Design Icons - AiFillCodeSandboxCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillCodeSandboxCircle
codesandbox, square, sandbox, code, dev, tool, brand - Ant Design Icons - AiFillCodeSandboxSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillCodeSandboxSquare
codepen, circle, pen, dev, tool, brand, editor - Ant Design Icons - AiFillCodepenCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillCodepenCircle
codepen, square, pen, dev, tool, brand, editor - Ant Design Icons - AiFillCodepenSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillCodepenSquare
dingtalk, brand, chat, messaging, circle, social, work - Ant Design Icons - AiFillDingtalkCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillDingtalkCircle
dingtalk, brand, chat, messaging, square, social, work - Ant Design Icons - AiFillDingtalkSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillDingtalkSquare
discord, brand, chat, gaming, community, social, voice - Ant Design Icons - AiFillDiscord - SVG | WEBP | PNG | JPG - Icon free download
AiFillDiscord
dribbble, brand, design, circle, community, portfolio, social - Ant Design Icons - AiFillDribbbleCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillDribbbleCircle
dribbble, brand, design, square, community, portfolio, social - Ant Design Icons - AiFillDribbbleSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillDribbbleSquare
dropbox, brand, cloud, storage, circle, files, sync - Ant Design Icons - AiFillDropboxCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillDropboxCircle
dropbox, brand, cloud, storage, square, files, sync - Ant Design Icons - AiFillDropboxSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillDropboxSquare
facebook, social, brand, network, share, media - Ant Design Icons - AiFillFacebook - SVG | WEBP | PNG | JPG - Icon free download
AiFillFacebook
github, brand, code, repo, developer, version-control - Ant Design Icons - AiFillGithub - SVG | WEBP | PNG | JPG - Icon free download
AiFillGithub
gitlab, brand, code, ci, repo, developer - Ant Design Icons - AiFillGitlab - SVG | WEBP | PNG | JPG - Icon free download
AiFillGitlab
google, brand, circle, logo, search, google-icon - Ant Design Icons - AiFillGoogleCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillGoogleCircle
google, google-plus, brand, circle, logo, social - Ant Design Icons - AiFillGooglePlusCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillGooglePlusCircle
google, google-plus, brand, square, logo, social - Ant Design Icons - AiFillGooglePlusSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillGooglePlusSquare
google, square, brand, logo, search, google-icon - Ant Design Icons - AiFillGoogleSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillGoogleSquare
id, idcard, identity, badge, profile, document - Ant Design Icons - AiFillIdcard - SVG | WEBP | PNG | JPG - Icon free download
AiFillIdcard
instagram, social, photo, media, social-network, brand - Ant Design Icons - AiFillInstagram - SVG | WEBP | PNG | JPG - Icon free download
AiFillInstagram
linkedin, social, professional, network, brand, profile - Ant Design Icons - AiFillLinkedin - SVG | WEBP | PNG | JPG - Icon free download
AiFillLinkedin
mail, email, envelope, message, inbox, send - Ant Design Icons - AiFillMail - SVG | WEBP | PNG | JPG - Icon free download
AiFillMail
medium, blog, publishing, social, brand - Ant Design Icons - AiFillMediumCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillMediumCircle
medium, blog, publishing, social, brand - Ant Design Icons - AiFillMediumSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillMediumSquare
mobile, smartphone, phone, device, responsive, handset - Ant Design Icons - AiFillMobile - SVG | WEBP | PNG | JPG - Icon free download
AiFillMobile
notification, bell, alert, notify, badge, reminder - Ant Design Icons - AiFillNotification - SVG | WEBP | PNG | JPG - Icon free download
AiFillNotification
openai, ai, gpt, brand, chatbot - Ant Design Icons - AiFillOpenAI - SVG | WEBP | PNG | JPG - Icon free download
AiFillOpenAI
phone, call, telephone, contact, call-button, handset - Ant Design Icons - AiFillPhone - SVG | WEBP | PNG | JPG - Icon free download
AiFillPhone
pinterest, social, pinboard, image, brand - Ant Design Icons - AiFillPinterest - SVG | WEBP | PNG | JPG - Icon free download
AiFillPinterest
printer, print, hardcopy, device, print-job, office - Ant Design Icons - AiFillPrinter - SVG | WEBP | PNG | JPG - Icon free download
AiFillPrinter
qq, tencent, social, messenger, brand - Ant Design Icons - AiFillQqCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillQqCircle
qq, tencent, social, messenger, brand - Ant Design Icons - AiFillQqSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillQqSquare
reddit, logo, circle, brand, social, community, forum - Ant Design Icons - AiFillRedditCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillRedditCircle
reddit, logo, square, brand, social, community, forum - Ant Design Icons - AiFillRedditSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillRedditSquare
robot, bot, ai, automation, machine, assistant, tech - Ant Design Icons - AiFillRobot - SVG | WEBP | PNG | JPG - Icon free download
AiFillRobot
safety, certificate, badge, secure, verified, trust, approval - Ant Design Icons - AiFillSafetyCertificate - SVG | WEBP | PNG | JPG - Icon free download
AiFillSafetyCertificate
security, scan, shield, protection, check, detect, safe - Ant Design Icons - AiFillSecurityScan - SVG | WEBP | PNG | JPG - Icon free download
AiFillSecurityScan
sketch, logo, brand, design, circle, tool, ui - Ant Design Icons - AiFillSketchCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillSketchCircle
sketch, logo, brand, design, square, tool, ui - Ant Design Icons - AiFillSketchSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillSketchSquare
skype, brand, call, chat, video, message, voip, social - Ant Design Icons - AiFillSkype - SVG | WEBP | PNG | JPG - Icon free download
AiFillSkype
slack, brand, chat, team, workspace, circle, message, collab - Ant Design Icons - AiFillSlackCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillSlackCircle
slack, brand, chat, team, workspace, square, message, collab - Ant Design Icons - AiFillSlackSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillSlackSquare
spotify, brand, music, audio, stream, playlist, social - Ant Design Icons - AiFillSpotify - SVG | WEBP | PNG | JPG - Icon free download
AiFillSpotify
tablet, device, screen, mobile, pad, touch, display - Ant Design Icons - AiFillTablet - SVG | WEBP | PNG | JPG - Icon free download
AiFillTablet
tag, label, price, discount, badge, shop, sale - Ant Design Icons - AiFillTag - SVG | WEBP | PNG | JPG - Icon free download
AiFillTag
taobao, brand, china, ecommerce, market, circle, store - Ant Design Icons - AiFillTaobaoCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillTaobaoCircle
taobao, square, marketplace, shopping, brand, logo - Ant Design Icons - AiFillTaobaoSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillTaobaoSquare
tiktok, music, video, social, brand, logo - Ant Design Icons - AiFillTikTok - SVG | WEBP | PNG | JPG - Icon free download
AiFillTikTok
trademark, tm, circle, brand, rights, legal - Ant Design Icons - AiFillTrademarkCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillTrademarkCircle
twitch, stream, gaming, video, brand, logo - Ant Design Icons - AiFillTwitch - SVG | WEBP | PNG | JPG - Icon free download
AiFillTwitch
twitter, circle, tweet, social, brand, logo - Ant Design Icons - AiFillTwitterCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillTwitterCircle
twitter, square, tweet, social, brand, logo - Ant Design Icons - AiFillTwitterSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillTwitterSquare
unlock, open, access, security, permission, key - Ant Design Icons - AiFillUnlock - SVG | WEBP | PNG | JPG - Icon free download
AiFillUnlock
wechat, work, chat, message, brand, logo - Ant Design Icons - AiFillWechatWork - SVG | WEBP | PNG | JPG - Icon free download
AiFillWechatWork
wechat, chat, message, social, logo, brand - Ant Design Icons - AiFillWechat - SVG | WEBP | PNG | JPG - Icon free download
AiFillWechat
weibo, circle, social, logo, brand, microblog - Ant Design Icons - AiFillWeiboCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillWeiboCircle
weibo, square, social, logo, brand, microblog - Ant Design Icons - AiFillWeiboSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillWeiboSquare
windows, microsoft, os, logo, brand, system - Ant Design Icons - AiFillWindows - SVG | WEBP | PNG | JPG - Icon free download
AiFillWindows
x, twitter, logo, brand, social, microblog - Ant Design Icons - AiFillX - SVG | WEBP | PNG | JPG - Icon free download
AiFillX
yahoo, logo, brand, mail, portal, search - Ant Design Icons - AiFillYahoo - SVG | WEBP | PNG | JPG - Icon free download
AiFillYahoo
youtube, video, play, logo, brand, media - Ant Design Icons - AiFillYoutube - SVG | WEBP | PNG | JPG - Icon free download
AiFillYoutube
yuque, docs, wiki, logo, brand, knowledge - Ant Design Icons - AiFillYuque - SVG | WEBP | PNG | JPG - Icon free download
AiFillYuque
zhihu, circle, qa, logo, brand, knowledge - Ant Design Icons - AiFillZhihuCircle - SVG | WEBP | PNG | JPG - Icon free download
AiFillZhihuCircle
zhihu, square, qa, logo, brand, knowledge - Ant Design Icons - AiFillZhihuSquare - SVG | WEBP | PNG | JPG - Icon free download
AiFillZhihuSquare
alibaba, logo, brand, commerce, marketplace, outline - Ant Design Icons - AiOutlineAlibaba - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAlibaba
alipay, circle, payment, logo, brand, wallet - Ant Design Icons - AiOutlineAlipayCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAlipayCircle
alipay, logo, brand, payment, wallet, outline - Ant Design Icons - AiOutlineAlipay - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAlipay
aliwangwang, chat, message, brand, logo, outline - Ant Design Icons - AiOutlineAliwangwang - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAliwangwang
aliyun, cloud, compute, brand, logo, outline - Ant Design Icons - AiOutlineAliyun - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAliyun
amazon, logo, brand, store, commerce, outline - Ant Design Icons - AiOutlineAmazon - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAmazon
android, robot, logo, brand, mobile, outline - Ant Design Icons - AiOutlineAndroid - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAndroid
ant, design, antdesign, ui, logo, outline - Ant Design Icons - AiOutlineAntDesign - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineAntDesign
apple, logo, brand, mac, ios, outline - Ant Design Icons - AiOutlineApple - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineApple
baidu, brand, logo, search, china, engine - Ant Design Icons - AiOutlineBaidu - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBaidu
behance, square, logo, design, portfolio, brand - Ant Design Icons - AiOutlineBehanceSquare - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBehanceSquare
behance, logo, design, portfolio, creative, brand - Ant Design Icons - AiOutlineBehance - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBehance
bilibili, logo, video, china, brand, anime - Ant Design Icons - AiOutlineBilibili - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineBilibili
chrome, google, browser, web, internet, brand, navigation - Ant Design Icons - AiOutlineChrome - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineChrome
codesandbox, sandbox, dev, code, tool, editor, brand - Ant Design Icons - AiOutlineCodeSandbox - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCodeSandbox
codepen, circle, pen, editor, dev, brand, playground - Ant Design Icons - AiOutlineCodepenCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCodepenCircle
codepen, pen, editor, dev, frontend, brand, playground - Ant Design Icons - AiOutlineCodepen - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCodepen
crown, royal, premium, king, queen, vip, badge - Ant Design Icons - AiOutlineCrown - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineCrown
dingding, brand, chat, communication, message, im, enterprise - Ant Design Icons - AiOutlineDingding - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDingding
dingtalk, brand, chat, communication, message, im, enterprise - Ant Design Icons - AiOutlineDingtalk - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDingtalk
discord, brand, chat, server, gaming, community, message - Ant Design Icons - AiOutlineDiscord - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDiscord
docker, containers, devops, platform, cloud, deployment - Ant Design Icons - AiOutlineDocker - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDocker
dribbble, square, brand, design, community, social - Ant Design Icons - AiOutlineDribbbleSquare - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDribbbleSquare
dribbble, brand, design, community, ball, social - Ant Design Icons - AiOutlineDribbble - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDribbble
dropbox, cloud, storage, file, sync, brand - Ant Design Icons - AiOutlineDropbox - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineDropbox
facebook, social, meta, share, network, brand, community - Ant Design Icons - AiOutlineFacebook - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineFacebook
github, brand, code, repository, developer, version-control - Ant Design Icons - AiOutlineGithub - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineGithub
gitlab, brand, ci, cd, repository, devops, code - Ant Design Icons - AiOutlineGitlab - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineGitlab
google-plus, google, brand, social, share, platform - Ant Design Icons - AiOutlineGooglePlus - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineGooglePlus
google, brand, search, engine, web, platform - Ant Design Icons - AiOutlineGoogle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineGoogle
harmonyos, os, huawei, system, brand, software, platform - Ant Design Icons - AiOutlineHarmonyOS - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineHarmonyOS
html5, web, code, markup, frontend, brand, developer - Ant Design Icons - AiOutlineHtml5 - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineHtml5
id, card, identity, badge, profile, document, access - Ant Design Icons - AiOutlineIdcard - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineIdcard
ie, internet-explorer, browser, microsoft, legacy, web, brand - Ant Design Icons - AiOutlineIe - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineIe
inbox, mail, messages, storage, tray, receive, email - Ant Design Icons - AiOutlineInbox - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineInbox
instagram, social, photo, media, brand, share, camera - Ant Design Icons - AiOutlineInstagram - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineInstagram
insurance, shield, coverage, policy, protection, security - Ant Design Icons - AiOutlineInsurance - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineInsurance
interaction, connect, engage, actions, ui, communication - Ant Design Icons - AiOutlineInteraction - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineInteraction
javascript, js, code, programming, script, developer, brand - Ant Design Icons - AiOutlineJavaScript - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineJavaScript
java, code, programming, developer, language, brand - Ant Design Icons - AiOutlineJava - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineJava
key, unlock, password, access, login, security, credential - Ant Design Icons - AiOutlineKey - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineKey
kubernetes, k8s, containers, devops, orchestration, brand - Ant Design Icons - AiOutlineKubernetes - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineKubernetes
laptop, computer, device, work, desktop, hardware - Ant Design Icons - AiOutlineLaptop - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLaptop
linkedin, social, network, profile, business, brand, connect - Ant Design Icons - AiOutlineLinkedin - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLinkedin
linux, os, penguin, system, kernel, open-source, brand - Ant Design Icons - AiOutlineLinux - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLinux
lock, secure, security, privacy, protected, password, auth - Ant Design Icons - AiOutlineLock - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineLock
mail, email, message, inbox, letter, send, communication - Ant Design Icons - AiOutlineMail - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMail
medium, logo, brand, blog, writing, publish, social - Ant Design Icons - AiOutlineMediumWorkmark - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMediumWorkmark
medium, logo, brand, blog, writing, content, publish - Ant Design Icons - AiOutlineMedium - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMedium
message, chat, text, bubble, dm, communication, comment - Ant Design Icons - AiOutlineMessage - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMessage
mobile, phone, smartphone, device, handheld, screen, responsive - Ant Design Icons - AiOutlineMobile - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineMobile
openai, brand, ai, logo, machine-learning, ml, tool - Ant Design Icons - AiOutlineOpenAI - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineOpenAI
phone, call, contact, mobile, communication, dial, support - Ant Design Icons - AiOutlinePhone - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePhone
pinterest, social, brand, pin, share, network, media - Ant Design Icons - AiOutlinePinterest - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePinterest
printer, print, document, paper, office, device, output - Ant Design Icons - AiOutlinePrinter - SVG | WEBP | PNG | JPG - Icon free download
AiOutlinePrinter
qq, chat, messaging, social, tencent, profile - Ant Design Icons - AiOutlineQq - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineQq
qr, qrcode, scan, barcode, code, mobile - Ant Design Icons - AiOutlineQrcode - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineQrcode
reddit, social, community, forum, brand, chat - Ant Design Icons - AiOutlineReddit - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineReddit
robot, bot, automation, ai, machine, tech, assistant - Ant Design Icons - AiOutlineRobot - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineRobot
security, scan, shield, detect, malware, inspection - Ant Design Icons - AiOutlineSecurityScan - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSecurityScan
sketch, logo, brand, design, tool, vector - Ant Design Icons - AiOutlineSketch - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSketch
skype, call, video, chat, brand, voip - Ant Design Icons - AiOutlineSkype - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSkype
slack, square, chat, team, collaboration, brand - Ant Design Icons - AiOutlineSlackSquare - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSlackSquare
slack, chat, team, collaboration, brand, workspace - Ant Design Icons - AiOutlineSlack - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSlack
spotify, music, audio, streaming, brand, playlist - Ant Design Icons - AiOutlineSpotify - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineSpotify
tablet, device, mobile, screen, electronics, touch, display - Ant Design Icons - AiOutlineTablet - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTablet
tag, label, price, discount, sale, badge, category - Ant Design Icons - AiOutlineTag - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTag
taobao, circle, logo, china, shopping, ecommerce - Ant Design Icons - AiOutlineTaobaoCircle - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTaobaoCircle
taobao, logo, china, shopping, marketplace, ecommerce - Ant Design Icons - AiOutlineTaobao - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTaobao
tiktok, logo, video, social media, short video, music - Ant Design Icons - AiOutlineTikTok - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTikTok
trademark, tm, brand, registered, intellectual property, legal - Ant Design Icons - AiOutlineTrademark - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTrademark
twitch, logo, streaming, gaming, live stream, video - Ant Design Icons - AiOutlineTwitch - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTwitch
twitter, x, logo, social media, tweet, bird - Ant Design Icons - AiOutlineTwitter - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineTwitter
unlock, open, unlocked, padlock, access, security - Ant Design Icons - AiOutlineUnlock - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineUnlock
usb, flash drive, pendrive, storage, device, port - Ant Design Icons - AiOutlineUsb - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineUsb
verified, check, badge, authentication, trust, approved, valid - Ant Design Icons - AiOutlineVerified - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineVerified
wechat, work, enterprise, chat, messaging, business - Ant Design Icons - AiOutlineWechatWork - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineWechatWork
wechat, chat, messaging, social, china, message - Ant Design Icons - AiOutlineWechat - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineWechat
whatsapp, messaging, chat, message, whatsapp, call - Ant Design Icons - AiOutlineWhatsApp - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineWhatsApp
windows, microsoft, os, operating system, logo - Ant Design Icons - AiOutlineWindows - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineWindows
yahoo, logo, brand, email, search, portal - Ant Design Icons - AiOutlineYahoo - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineYahoo
youtube, video, logo, brand, streaming, play - Ant Design Icons - AiOutlineYoutube - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineYoutube
yuque, logo, knowledge, docs, notes, ant - Ant Design Icons - AiOutlineYuque - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineYuque
zhihu, logo, q&a, questions, answers, china - Ant Design Icons - AiOutlineZhihu - SVG | WEBP | PNG | JPG - Icon free download
AiOutlineZhihu
camera, photo, picture, image, media, capture, device, photography - Ant Design Icons - AiTwotoneCamera - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCamera
ci, corporate, identity, symbol, information, brand, finance, currency - Ant Design Icons - AiTwotoneCi - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCi
contacts, address, book, people, friends, user, directory, communication - Ant Design Icons - AiTwotoneContacts - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneContacts
crown, royal, king, queen, vip, premium, badge - Ant Design Icons - AiTwotoneCrown - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneCrown
html5, web, code, markup, frontend, brand - Ant Design Icons - AiTwotoneHtml5 - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneHtml5
id, card, identity, badge, profile, verification - Ant Design Icons - AiTwotoneIdcard - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneIdcard
insurance, protection, policy, coverage, security, risk - Ant Design Icons - AiTwotoneInsurance - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneInsurance
mail, email, message, inbox, send, letter, communication - Ant Design Icons - AiTwotoneMail - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneMail
message, chat, bubble, conversation, sms, talk, communication - Ant Design Icons - AiTwotoneMessage - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneMessage
mobile, phone, smartphone, device, call, cell, handset - Ant Design Icons - AiTwotoneMobile - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneMobile
phone, call, telephone, contact, dial, voice, communication - Ant Design Icons - AiTwotonePhone - SVG | WEBP | PNG | JPG - Icon free download
AiTwotonePhone
printer, print, document, paper, office, device, hardware - Ant Design Icons - AiTwotonePrinter - SVG | WEBP | PNG | JPG - Icon free download
AiTwotonePrinter
security, scan, shield, protection, check, detect, safe - Ant Design Icons - AiTwotoneSecurityScan - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneSecurityScan
tablet, device, screen, mobile, touch, display - Ant Design Icons - AiTwotoneTablet - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneTablet
trademark, tm, brand, legal, circle, mark - Ant Design Icons - AiTwotoneTrademarkCircle - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneTrademarkCircle
unlock, open, lock, access, permission, security - Ant Design Icons - AiTwotoneUnlock - SVG | WEBP | PNG | JPG - Icon free download
AiTwotoneUnlock
at, email, address, symbol, contact, mention - BoxIcons - BiAt - SVG | WEBP | PNG | JPG - Icon free download
BiAt
award, badge, trophy, prize, achievement, recognition - BoxIcons - BiAward - SVG | WEBP | PNG | JPG - Icon free download
BiAward
badge, check, verify, approved, status, validation, tick - BoxIcons - BiBadgeCheck - SVG | WEBP | PNG | JPG - Icon free download
BiBadgeCheck
badge, label, tag, identifier, ui, mark - BoxIcons - BiBadge - SVG | WEBP | PNG | JPG - Icon free download
BiBadge
bluetooth, wireless, connect, pair, signal, device, tech - BoxIcons - BiBluetooth - SVG | WEBP | PNG | JPG - Icon free download
BiBluetooth
camera, home, security, cctv, monitor, surveillance, video - BoxIcons - BiCameraHome - SVG | WEBP | PNG | JPG - Icon free download
BiCameraHome
cctv, camera, surveillance, monitor, security, watch - BoxIcons - BiCctv - SVG | WEBP | PNG | JPG - Icon free download
BiCctv
certificate, award, badge, seal, verified, achievement - BoxIcons - BiCertification - SVG | WEBP | PNG | JPG - Icon free download
BiCertification
crown, royal, king, queen, premium, vip, badge - BoxIcons - BiCrown - SVG | WEBP | PNG | JPG - Icon free download
BiCrown
desktop, monitor, screen, computer, pc, workstation, device - BoxIcons - BiDesktop - SVG | WEBP | PNG | JPG - Icon free download
BiDesktop
devices, screens, monitor, tablet, phone, electronics, hardware - BoxIcons - BiDevices - SVG | WEBP | PNG | JPG - Icon free download
BiDevices
dialpad, phone, call, numbers, keypad, alt, telecom - BoxIcons - BiDialpadAlt - SVG | WEBP | PNG | JPG - Icon free download
BiDialpadAlt
dialpad, keypad, call, phone, numbers, pad, telephony - BoxIcons - BiDialpad - SVG | WEBP | PNG | JPG - Icon free download
BiDialpad
envelope, open, mail, message, email, inbox, letter - BoxIcons - BiEnvelopeOpen - SVG | WEBP | PNG | JPG - Icon free download
BiEnvelopeOpen
envelope, mail, message, email, letter, send, inbox - BoxIcons - BiEnvelope - SVG | WEBP | PNG | JPG - Icon free download
BiEnvelope
fingerprint, identity, biometric, security, scan, unlock, auth - BoxIcons - BiFingerprint - SVG | WEBP | PNG | JPG - Icon free download
BiFingerprint
hdd, hard-drive, storage, disk, device, memory, hardware - BoxIcons - BiHdd - SVG | WEBP | PNG | JPG - Icon free download
BiHdd
headphone, audio, music, sound, listen, media, device - BoxIcons - BiHeadphone - SVG | WEBP | PNG | JPG - Icon free download
BiHeadphone
id, card, identity, badge, profile, credentials - BoxIcons - BiIdCard - SVG | WEBP | PNG | JPG - Icon free download
BiIdCard
joystick, game, controller, arcade, play, gaming, device - BoxIcons - BiJoystickAlt - SVG | WEBP | PNG | JPG - Icon free download
BiJoystickAlt
joystick, controller, game, arcade, gaming, device, control - BoxIcons - BiJoystick - SVG | WEBP | PNG | JPG - Icon free download
BiJoystick
key, unlock, access, login, auth, security, credential - BoxIcons - BiKey - SVG | WEBP | PNG | JPG - Icon free download
BiKey
label, tag, badge, sticker, price, tagging, mark - BoxIcons - BiLabel - SVG | WEBP | PNG | JPG - Icon free download
BiLabel
laptop, computer, pc, device, work, coding, technology - BoxIcons - BiLaptop - SVG | WEBP | PNG | JPG - Icon free download
BiLaptop
mail, send, email, message, outbox, paper-plane - BoxIcons - BiMailSend - SVG | WEBP | PNG | JPG - Icon free download
BiMailSend
medal, award, achievement, win, badge, trophy - BoxIcons - BiMedal - SVG | WEBP | PNG | JPG - Icon free download
BiMedal
memory-card, storage, sd-card, data, device, media - BoxIcons - BiMemoryCard - SVG | WEBP | PNG | JPG - Icon free download
BiMemoryCard
mobile, alt, phone, smartphone, device, call, screen - BoxIcons - BiMobileAlt - SVG | WEBP | PNG | JPG - Icon free download
BiMobileAlt
mobile, landscape, phone, rotate, orientation, device, screen - BoxIcons - BiMobileLandscape - SVG | WEBP | PNG | JPG - Icon free download
BiMobileLandscape
mobile, vibration, phone, alert, notify, device, shake - BoxIcons - BiMobileVibration - SVG | WEBP | PNG | JPG - Icon free download
BiMobileVibration
mobile, phone, smartphone, device, call, screen, communication - BoxIcons - BiMobile - SVG | WEBP | PNG | JPG - Icon free download
BiMobile
mouse, alt, pointer, computer, input, device, navigation - BoxIcons - BiMouseAlt - SVG | WEBP | PNG | JPG - Icon free download
BiMouseAlt
mouse, computer, pointer, input, device, navigation, cursor - BoxIcons - BiMouse - SVG | WEBP | PNG | JPG - Icon free download
BiMouse
paper, plane, send, message, submit, email, fly - BoxIcons - BiPaperPlane - SVG | WEBP | PNG | JPG - Icon free download
BiPaperPlane
phone, call, dial, talk, voice, contact, communication - BoxIcons - BiPhoneCall - SVG | WEBP | PNG | JPG - Icon free download
BiPhoneCall
phone, incoming, call, receive, ring, contact, communication - BoxIcons - BiPhoneIncoming - SVG | WEBP | PNG | JPG - Icon free download
BiPhoneIncoming
phone, off, mute, disconnect, call, hangup - BoxIcons - BiPhoneOff - SVG | WEBP | PNG | JPG - Icon free download
BiPhoneOff
phone, outgoing, call, dial, send-call, contact - BoxIcons - BiPhoneOutgoing - SVG | WEBP | PNG | JPG - Icon free download
BiPhoneOutgoing
phone, call, mobile, device, contact, dial - BoxIcons - BiPhone - SVG | WEBP | PNG | JPG - Icon free download
BiPhone
registered, r, trademark, legal, brand, protection, symbol - BoxIcons - BiRegistered - SVG | WEBP | PNG | JPG - Icon free download
BiRegistered
reply, reply-all, email, message, response, send, arrow - BoxIcons - BiReplyAll - SVG | WEBP | PNG | JPG - Icon free download
BiReplyAll
reply, respond, email, message, arrow, send - BoxIcons - BiReply - SVG | WEBP | PNG | JPG - Icon free download
BiReply
shield, protect, security, alt, safe, guard, defense - BoxIcons - BiShieldAlt2 - SVG | WEBP | PNG | JPG - Icon free download
BiShieldAlt2
shield, protection, safe, guard, security, alt, defense - BoxIcons - BiShieldAlt - SVG | WEBP | PNG | JPG - Icon free download
BiShieldAlt
shield, minus, remove, protection, security, reduce, alert - BoxIcons - BiShieldMinus - SVG | WEBP | PNG | JPG - Icon free download
BiShieldMinus
shield, plus, add, protection, security, enhance, safe - BoxIcons - BiShieldPlus - SVG | WEBP | PNG | JPG - Icon free download
BiShieldPlus
shield, quarter, segment, protection, security, defense, status - BoxIcons - BiShieldQuarter - SVG | WEBP | PNG | JPG - Icon free download
BiShieldQuarter
shield, x, deny, block, security, error, forbidden - BoxIcons - BiShieldX - SVG | WEBP | PNG | JPG - Icon free download
BiShieldX
shield, protect, security, guard, safe, defense - BoxIcons - BiShield - SVG | WEBP | PNG | JPG - Icon free download
BiShield
user, voice, speak, audio, profile, communication, mic - BoxIcons - BiUserVoice - SVG | WEBP | PNG | JPG - Icon free download
BiUserVoice
voicemail, audio, message, inbox, phone, recording, call - BoxIcons - BiVoicemail - SVG | WEBP | PNG | JPG - Icon free download
BiVoicemail
webcam, camera, video, stream, record, device, webcam-icon - BoxIcons - BiWebcam - SVG | WEBP | PNG | JPG - Icon free download
BiWebcam
windows, microsoft, os, brand, system, software, desktop - BoxIcons - BiWindows - SVG | WEBP | PNG | JPG - Icon free download
BiWindows
award, badge, medal, trophy, achievement, prize, recognition, honor - BoxIcons - BiSolidAward - SVG | WEBP | PNG | JPG - Icon free download
BiSolidAward
badge, check, verified, verification, trust, security, identity - BoxIcons - BiSolidBadgeCheck - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBadgeCheck
badge, dollar, money, price, reward, discount, payment, finance - BoxIcons - BiSolidBadgeDollar - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBadgeDollar
badge, label, award, tag, mark, ui, identifier - BoxIcons - BiSolidBadge - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBadge
battery, charging, power, energy, device, charge - BoxIcons - BiSolidBatteryCharging - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBatteryCharging
battery, full, power, energy, charged, device - BoxIcons - BiSolidBatteryFull - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBatteryFull
battery, low, warning, power, energy, device, status - BoxIcons - BiSolidBatteryLow - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBatteryLow
battery, power, energy, level, device, status - BoxIcons - BiSolidBattery - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBattery
business, company, office, building, work, corporate, enterprise - BoxIcons - BiSolidBusiness - SVG | WEBP | PNG | JPG - Icon free download
BiSolidBusiness
camera, home, security, surveillance, monitor, cctv, smart-home - BoxIcons - BiSolidCameraHome - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCameraHome
cctv, camera, surveillance, security, monitoring, record - BoxIcons - BiSolidCctv - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCctv
certificate, award, badge, verified, document, achievement - BoxIcons - BiSolidCertification - SVG | WEBP | PNG | JPG - Icon free download
BiSolidCertification
chat, message, talk, conversation, bubble, communication - BoxIcons - BiSolidChat - SVG | WEBP | PNG | JPG - Icon free download
BiSolidChat
devices, monitor, tablet, phone, electronics, screens - BoxIcons - BiSolidDevices - SVG | WEBP | PNG | JPG - Icon free download
BiSolidDevices
envelope, open, email, message, mail, letter, inbox - BoxIcons - BiSolidEnvelopeOpen - SVG | WEBP | PNG | JPG - Icon free download
BiSolidEnvelopeOpen
envelope, email, message, mail, letter, send - BoxIcons - BiSolidEnvelope - SVG | WEBP | PNG | JPG - Icon free download
BiSolidEnvelope
hdd, drive, storage, disk, hardware, device - BoxIcons - BiSolidHdd - SVG | WEBP | PNG | JPG - Icon free download
BiSolidHdd
hide, eye-off, private, conceal, visibility, security - BoxIcons - BiSolidHide - SVG | WEBP | PNG | JPG - Icon free download
BiSolidHide
id-card, badge, identity, user, profile, credentials - BoxIcons - BiSolidIdCard - SVG | WEBP | PNG | JPG - Icon free download
BiSolidIdCard
inbox, mail, messages, storage, email, tray - BoxIcons - BiSolidInbox - SVG | WEBP | PNG | JPG - Icon free download
BiSolidInbox
key, lock, unlock, access, security, password - BoxIcons - BiSolidKey - SVG | WEBP | PNG | JPG - Icon free download
BiSolidKey
keyboard, typing, input, device, computer, keys - BoxIcons - BiSolidKeyboard - SVG | WEBP | PNG | JPG - Icon free download
BiSolidKeyboard
label, tag, sticker, badge, price, marker - BoxIcons - BiSolidLabel - SVG | WEBP | PNG | JPG - Icon free download
BiSolidLabel
lock-open, unlock, open, access, security, padlock - BoxIcons - BiSolidLockOpenAlt - SVG | WEBP | PNG | JPG - Icon free download
BiSolidLockOpenAlt
unlock, open, lock-open, access, security, padlock - BoxIcons - BiSolidLockOpen - SVG | WEBP | PNG | JPG - Icon free download
BiSolidLockOpen
memory-card, storage, sd-card, file, device, data - BoxIcons - BiSolidMemoryCard - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMemoryCard
message, add, chat, new-message, plus, communication - BoxIcons - BiSolidMessageAdd - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMessageAdd
microchip, chip, processor, hardware, cpu, tech, circuit - BoxIcons - BiSolidMicrochip - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMicrochip
mobile, vibration, phone, alert, shake, ring, silent - BoxIcons - BiSolidMobileVibration - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMobileVibration
mobile, phone, smartphone, device, call, handheld - BoxIcons - BiSolidMobile - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMobile
mouse, alt, pointer, device, cursor, input, computer - BoxIcons - BiSolidMouseAlt - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMouseAlt
mouse, pointer, cursor, input, device, click, computer - BoxIcons - BiSolidMouse - SVG | WEBP | PNG | JPG - Icon free download
BiSolidMouse
phone, call, dial, contact, voice, mobile, communication - BoxIcons - BiSolidPhoneCall - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPhoneCall
phone, incoming, call, receive, contact, ring, mobile - BoxIcons - BiSolidPhoneIncoming - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPhoneIncoming
phone, off, mute, disconnect, silent, disabled, mobile - BoxIcons - BiSolidPhoneOff - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPhoneOff
phone, outgoing, call, dial, send, contact, mobile - BoxIcons - BiSolidPhoneOutgoing - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPhoneOutgoing
phone, mobile, call, contact, device, communication, dial - BoxIcons - BiSolidPhone - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPhone
plug, power, connect, socket, adapter, electric, device - BoxIcons - BiSolidPlug - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPlug
printer, print, device, paper, document, office, output - BoxIcons - BiSolidPrinter - SVG | WEBP | PNG | JPG - Icon free download
BiSolidPrinter
registered, trademark, legal, symbol, brand, rights - BoxIcons - BiSolidRegistered - SVG | WEBP | PNG | JPG - Icon free download
BiSolidRegistered
shield, protection, secure, security, guard, defense - BoxIcons - BiSolidShieldAlt2 - SVG | WEBP | PNG | JPG - Icon free download
BiSolidShieldAlt2
shield, minus, remove, protection, security, disable - BoxIcons - BiSolidShieldMinus - SVG | WEBP | PNG | JPG - Icon free download
BiSolidShieldMinus
shield, plus, add, security, enhanced, protection - BoxIcons - BiSolidShieldPlus - SVG | WEBP | PNG | JPG - Icon free download
BiSolidShieldPlus
shield, x, block, deny, security, protection - BoxIcons - BiSolidShieldX - SVG | WEBP | PNG | JPG - Icon free download
BiSolidShieldX
shield, security, protection, guard, safe, defense - BoxIcons - BiSolidShield - SVG | WEBP | PNG | JPG - Icon free download
BiSolidShield
sticker, label, tag, badge, mark, decor, note - BoxIcons - BiSolidSticker - SVG | WEBP | PNG | JPG - Icon free download
BiSolidSticker
tag, label, price, sale, discount, product, badge - BoxIcons - BiSolidTag - SVG | WEBP | PNG | JPG - Icon free download
BiSolidTag
user, badge, id, credential, profile, identity - BoxIcons - BiSolidUserBadge - SVG | WEBP | PNG | JPG - Icon free download
BiSolidUserBadge
500px, photography, photos, portfolio, brand, social - BoxIcons - BiLogo500Px - SVG | WEBP | PNG | JPG - Icon free download
BiLogo500Px
99designs, design, freelance, creative, brand, logo - BoxIcons - BiLogo99Designs - SVG | WEBP | PNG | JPG - Icon free download
BiLogo99Designs
adobe, creative, software, design, photoshop, brand - BoxIcons - BiLogoAdobe - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAdobe
airbnb, travel, stay, booking, rent, brand - BoxIcons - BiLogoAirbnb - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAirbnb
algolia, search, api, index, brand, developer - BoxIcons - BiLogoAlgolia - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAlgolia
amazon, shopping, ecommerce, store, brand, retail - BoxIcons - BiLogoAmazon - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAmazon
android, mobile, os, google, brand, robot - BoxIcons - BiLogoAndroid - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAndroid
angular, framework, frontend, web, brand, developer - BoxIcons - BiLogoAngular - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAngular
apple, ios, mac, brand, tech, device - BoxIcons - BiLogoApple - SVG | WEBP | PNG | JPG - Icon free download
BiLogoApple
audible, audio, books, podcast, brand, listen - BoxIcons - BiLogoAudible - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAudible
aws, amazon, cloud, server, hosting, brand - BoxIcons - BiLogoAws - SVG | WEBP | PNG | JPG - Icon free download
BiLogoAws
baidu, search, china, engine, brand, web - BoxIcons - BiLogoBaidu - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBaidu
behance, design, portfolio, creative, brand, art - BoxIcons - BiLogoBehance - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBehance
bing, search, engine, microsoft, brand, web - BoxIcons - BiLogoBing - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBing
bitcoin, crypto, currency, btc, brand, payment - BoxIcons - BiLogoBitcoin - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBitcoin
blender, 3d, modeling, animation, render, design, brand - BoxIcons - BiLogoBlender - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBlender
blogger, blog, write, post, google, brand, content - BoxIcons - BiLogoBlogger - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBlogger
bootstrap, css, framework, ui, web, design, brand - BoxIcons - BiLogoBootstrap - SVG | WEBP | PNG | JPG - Icon free download
BiLogoBootstrap
c++, cpp, programming, code, language, developer, brand - BoxIcons - BiLogoCPlusPlus - SVG | WEBP | PNG | JPG - Icon free download
BiLogoCPlusPlus
chrome, google, browser, web, internet, brand, navigate - BoxIcons - BiLogoChrome - SVG | WEBP | PNG | JPG - Icon free download
BiLogoChrome
codepen, code, snippet, frontend, developer, brand, share - BoxIcons - BiLogoCodepen - SVG | WEBP | PNG | JPG - Icon free download
BiLogoCodepen
creative, commons, cc, license, rights, brand, media - BoxIcons - BiLogoCreativeCommons - SVG | WEBP | PNG | JPG - Icon free download
BiLogoCreativeCommons
css, css3, style, web, design, frontend, brand - BoxIcons - BiLogoCss3 - SVG | WEBP | PNG | JPG - Icon free download
BiLogoCss3
dailymotion, video, media, stream, brand, watch, share - BoxIcons - BiLogoDailymotion - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDailymotion
deezer, music, audio, stream, brand, playlist, song - BoxIcons - BiLogoDeezer - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDeezer
devto, developer, blog, article, community, brand, tech - BoxIcons - BiLogoDevTo - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDevTo
deviantart, art, artist, gallery, design, brand, share - BoxIcons - BiLogoDeviantart - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDeviantart
digg, news, share, feed, social, brand, content - BoxIcons - BiLogoDigg - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDigg
digitalocean, cloud, hosting, server, deploy, brand, infrastructure - BoxIcons - BiLogoDigitalocean - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDigitalocean
discord, chat, server, community, gaming, brand, alt - BoxIcons - BiLogoDiscordAlt - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDiscordAlt
discord, chat, message, server, community, brand, gaming - BoxIcons - BiLogoDiscord - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDiscord
discourse, forum, discussion, community, threads, brand, chat - BoxIcons - BiLogoDiscourse - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDiscourse
django, python, framework, backend, web, developer, brand - BoxIcons - BiLogoDjango - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDjango
docker, container, devops, deploy, image, brand, infrastructure - BoxIcons - BiLogoDocker - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDocker
dribbble, design, shots, creative, portfolio, brand, share - BoxIcons - BiLogoDribbble - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDribbble
dropbox, storage, cloud, sync, files, brand, backup - BoxIcons - BiLogoDropbox - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDropbox
drupal, cms, website, content, developer, brand, platform - BoxIcons - BiLogoDrupal - SVG | WEBP | PNG | JPG - Icon free download
BiLogoDrupal
ebay, marketplace, buy, sell, auction, brand, shop - BoxIcons - BiLogoEbay - SVG | WEBP | PNG | JPG - Icon free download
BiLogoEbay
edge, microsoft, browser, web, internet, brand, navigate - BoxIcons - BiLogoEdge - SVG | WEBP | PNG | JPG - Icon free download
BiLogoEdge
etsy, marketplace, store, crafts, seller, shop, logo - BoxIcons - BiLogoEtsy - SVG | WEBP | PNG | JPG - Icon free download
BiLogoEtsy
facebook, circle, social, media, share, profile, logo - BoxIcons - BiLogoFacebookCircle - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFacebookCircle
facebook, square, social, media, share, profile, logo - BoxIcons - BiLogoFacebookSquare - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFacebookSquare
facebook, social, media, share, profile, logo, community - BoxIcons - BiLogoFacebook - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFacebook
figma, design, ui, ux, prototype, tool, logo - BoxIcons - BiLogoFigma - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFigma
firebase, backend, cloud, database, hosting, google, logo - BoxIcons - BiLogoFirebase - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFirebase
firefox, browser, mozilla, web, internet, logo, search - BoxIcons - BiLogoFirefox - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFirefox
flask, python, framework, backend, web, api, logo - BoxIcons - BiLogoFlask - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFlask
flickr, square, photos, images, gallery, social, logo - BoxIcons - BiLogoFlickrSquare - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFlickrSquare
flickr, photos, images, gallery, share, social, logo - BoxIcons - BiLogoFlickr - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFlickr
flutter, mobile, app, ui, framework, google, logo - BoxIcons - BiLogoFlutter - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFlutter
foursquare, location, checkin, map, social, explore, logo - BoxIcons - BiLogoFoursquare - SVG | WEBP | PNG | JPG - Icon free download
BiLogoFoursquare
git, version, control, repo, commit, developer, logo - BoxIcons - BiLogoGit - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGit
github, repo, code, version, developer, open source, logo - BoxIcons - BiLogoGithub - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGithub
gitlab, devops, repo, pipeline, ci, cd, logo - BoxIcons - BiLogoGitlab - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGitlab
gmail, email, mail, google, inbox, message, logo - BoxIcons - BiLogoGmail - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGmail
golang, go, language, backend, compiler, developer, logo - BoxIcons - BiLogoGoLang - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGoLang
google, cloud, gcp, hosting, compute, infrastructure, logo - BoxIcons - BiLogoGoogleCloud - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGoogleCloud
google, plus, circle, social, share, community, logo - BoxIcons - BiLogoGooglePlusCircle - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGooglePlusCircle
google, plus, social, media, share, community, logo - BoxIcons - BiLogoGooglePlus - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGooglePlus
google, search, engine, web, internet, logo, account - BoxIcons - BiLogoGoogle - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGoogle
graphql, api, schema, query, backend, developer, logo - BoxIcons - BiLogoGraphql - SVG | WEBP | PNG | JPG - Icon free download
BiLogoGraphql
heroku, hosting, cloud, deploy, app, platform, logo - BoxIcons - BiLogoHeroku - SVG | WEBP | PNG | JPG - Icon free download
BiLogoHeroku
html5, markup, web, frontend, developer, code, logo - BoxIcons - BiLogoHtml5 - SVG | WEBP | PNG | JPG - Icon free download
BiLogoHtml5
imdb, movies, ratings, films, database, reviews, logo - BoxIcons - BiLogoImdb - SVG | WEBP | PNG | JPG - Icon free download
BiLogoImdb
instagram, alt, photo, share, stories, camera, logo - BoxIcons - BiLogoInstagramAlt - SVG | WEBP | PNG | JPG - Icon free download
BiLogoInstagramAlt
instagram, photo, share, social, stories, camera, logo - BoxIcons - BiLogoInstagram - SVG | WEBP | PNG | JPG - Icon free download
BiLogoInstagram
internet, explorer, ie, browser, web, legacy, logo - BoxIcons - BiLogoInternetExplorer - SVG | WEBP | PNG | JPG - Icon free download
BiLogoInternetExplorer
invision, design, prototype, ui, ux, collaboration, logo - BoxIcons - BiLogoInvision - SVG | WEBP | PNG | JPG - Icon free download
BiLogoInvision
java, language, backend, oop, compiler, developer, logo - BoxIcons - BiLogoJava - SVG | WEBP | PNG | JPG - Icon free download
BiLogoJava
joomla, cms, website, platform, content, builder - BoxIcons - BiLogoJoomla - SVG | WEBP | PNG | JPG - Icon free download
BiLogoJoomla
magento, ecommerce, store, platform, shop, backend - BoxIcons - BiLogoMagento - SVG | WEBP | PNG | JPG - Icon free download
BiLogoMagento
mailchimp, email, marketing, newsletter, automation, campaign - BoxIcons - BiLogoMailchimp - SVG | WEBP | PNG | JPG - Icon free download
BiLogoMailchimp
medium, square, blog, writer, articles, platform - BoxIcons - BiLogoMediumSquare - SVG | WEBP | PNG | JPG - Icon free download
BiLogoMediumSquare
meta, facebook, company, brand, social, platform - BoxIcons - BiLogoMeta - SVG | WEBP | PNG | JPG - Icon free download
BiLogoMeta
microsoft, windows, company, software, brand, office - BoxIcons - BiLogoMicrosoft - SVG | WEBP | PNG | JPG - Icon free download
BiLogoMicrosoft
netlify, hosting, deploy, static, site, platform - BoxIcons - BiLogoNetlify - SVG | WEBP | PNG | JPG - Icon free download
BiLogoNetlify
producthunt, launch, startup, community, tech, share - BoxIcons - BiLogoProductHunt - SVG | WEBP | PNG | JPG - Icon free download
BiLogoProductHunt
steam, gaming, games, valve, platform, store, launcher - BoxIcons - BiLogoSteam - SVG | WEBP | PNG | JPG - Icon free download
BiLogoSteam
telegram, messaging, chat, social, app, group, channel - BoxIcons - BiLogoTelegram - SVG | WEBP | PNG | JPG - Icon free download
BiLogoTelegram
unity, engine, game-dev, 3d, development, platform, editor - BoxIcons - BiLogoUnity - SVG | WEBP | PNG | JPG - Icon free download
BiLogoUnity
whatsapp, square, chat, message, social, phone, app - BoxIcons - BiLogoWhatsappSquare - SVG | WEBP | PNG | JPG - Icon free download
BiLogoWhatsappSquare
whatsapp, chat, message, social, phone, group, app - BoxIcons - BiLogoWhatsapp - SVG | WEBP | PNG | JPG - Icon free download
BiLogoWhatsapp
yahoo, mail, portal, news, search, email, ymail - BoxIcons - BiLogoYahoo - SVG | WEBP | PNG | JPG - Icon free download
BiLogoYahoo
yelp, review, ratings, business, brand, social - BoxIcons - BiLogoYelp - SVG | WEBP | PNG | JPG - Icon free download
BiLogoYelp
youtube, video, play, media, brand, streaming - BoxIcons - BiLogoYoutube - SVG | WEBP | PNG | JPG - Icon free download
BiLogoYoutube
zoom, video, meeting, conference, brand, call - BoxIcons - BiLogoZoom - SVG | WEBP | PNG | JPG - Icon free download
BiLogoZoom
0, zero, number, digit, circle, badge - Bootstrap Icons - BsFill0CircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill0CircleFill
0, zero, number, digit, square, badge - Bootstrap Icons - BsFill0SquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill0SquareFill
1, one, number, digit, circle, badge - Bootstrap Icons - BsFill1CircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill1CircleFill
1, one, digit, number, square, badge, label, count - Bootstrap Icons - BsFill1SquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill1SquareFill
2, two, digit, number, circle, badge, label, count - Bootstrap Icons - BsFill2CircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill2CircleFill
2, two, digit, number, square, badge, label, count - Bootstrap Icons - BsFill2SquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill2SquareFill
3, three, digit, number, circle, badge, label, count - Bootstrap Icons - BsFill3CircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill3CircleFill
3, three, digit, number, square, badge, label, count - Bootstrap Icons - BsFill3SquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill3SquareFill
4, four, digit, number, circle, badge, label, count - Bootstrap Icons - BsFill4CircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill4CircleFill
4, four, digit, number, square, badge, label, count - Bootstrap Icons - BsFill4SquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill4SquareFill
5, five, digit, number, circle, badge, label, count - Bootstrap Icons - BsFill5CircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill5CircleFill
5, five, digit, number, square, badge, label, count - Bootstrap Icons - BsFill5SquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill5SquareFill
6, six, digit, number, circle, badge, label, count - Bootstrap Icons - BsFill6CircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill6CircleFill
6, six, digit, number, square, badge, label, count - Bootstrap Icons - BsFill6SquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill6SquareFill
7, seven, digit, number, circle, badge, label, count - Bootstrap Icons - BsFill7CircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill7CircleFill
7, seven, digit, number, square, badge, label, count - Bootstrap Icons - BsFill7SquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill7SquareFill
8, eight, digit, number, circle, badge, label, count - Bootstrap Icons - BsFill8CircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill8CircleFill
8, eight, digit, number, square, badge, label, count - Bootstrap Icons - BsFill8SquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill8SquareFill
9, nine, digit, number, circle, badge, label, count - Bootstrap Icons - BsFill9CircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill9CircleFill
9, nine, digit, number, square, badge, label, count - Bootstrap Icons - BsFill9SquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFill9SquareFill
award, medal, badge, prize, certificate, trophy, achievement - Bootstrap Icons - BsFillAwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillAwardFill
3d, badge, quality, media, label, format - Bootstrap Icons - BsFillBadge3dFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadge3dFill
4k, badge, ultra hd, media, quality, format - Bootstrap Icons - BsFillBadge4kFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadge4kFill
8k, badge, ultra hd, media, quality, format - Bootstrap Icons - BsFillBadge8kFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadge8kFill
ad, advertisement, badge, media, label, promo - Bootstrap Icons - BsFillBadgeAdFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeAdFill
ar, augmented reality, badge, media, tech, label - Bootstrap Icons - BsFillBadgeArFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeArFill
cc, closed captions, badge, subtitles, media, accessibility - Bootstrap Icons - BsFillBadgeCcFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeCcFill
hd, high definition, badge, media, quality, format - Bootstrap Icons - BsFillBadgeHdFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeHdFill
sd, standard definition, badge, media, quality, format - Bootstrap Icons - BsFillBadgeSdFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeSdFill
tm, trademark, badge, brand, legal, mark - Bootstrap Icons - BsFillBadgeTmFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeTmFill
vo, voiceover, badge, audio, label, media - Bootstrap Icons - BsFillBadgeVoFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeVoFill
vr, virtual reality, badge, media, tech, label - Bootstrap Icons - BsFillBadgeVrFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeVrFill
wc, restroom, toilet, bathroom, badge, facility - Bootstrap Icons - BsFillBadgeWcFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBadgeWcFill
bootstrap, framework, ui, css, brand, web - Bootstrap Icons - BsFillBootstrapFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillBootstrapFill
hdd, hard drive, storage, device, disk, hardware - Bootstrap Icons - BsFillDeviceHddFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDeviceHddFill
ssd, solid state drive, storage, device, disk, hardware - Bootstrap Icons - BsFillDeviceSsdFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDeviceSsdFill
display, monitor, screen, desktop, computer, device - Bootstrap Icons - BsFillDisplayFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillDisplayFill
envelope, mail, at, email, message, contact - Bootstrap Icons - BsFillEnvelopeAtFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillEnvelopeAtFill
envelope, mail, message, letter, email, communication - Bootstrap Icons - BsFillEnvelopeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillEnvelopeFill
key, unlock, access, security, password, credential, login - Bootstrap Icons - BsFillKeyFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillKeyFill
keyboard, typing, input, device, keys, pc, hardware - Bootstrap Icons - BsFillKeyboardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillKeyboardFill
motherboard, hardware, circuit, pc, tech, chip, electronics - Bootstrap Icons - BsFillMotherboardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMotherboardFill
mouse, pointer, cursor, input, hardware, pc, device - Bootstrap Icons - BsFillMouseFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMouseFill
mouse, input, scroll, device, pointer, hardware - Bootstrap Icons - BsFillMouse3Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillMouse3Fill
p, letter, circle, alphabet, badge, mark, symbol - Bootstrap Icons - BsFillPCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPCircleFill
p, letter, square, alphabet, badge, mark, symbol - Bootstrap Icons - BsFillPSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPSquareFill
patch, check, verified, approved, badge, secure, ok - Bootstrap Icons - BsFillPatchCheckFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPatchCheckFill
person, badge, id, user, profile, identity, card - Bootstrap Icons - BsFillPersonBadgeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPersonBadgeFill
phone, call, mobile, telephone, contact, device, handset - Bootstrap Icons - BsFillPhoneFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPhoneFill
phone, landscape, rotate, orientation, mobile, device, screen - Bootstrap Icons - BsFillPhoneLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPhoneLandscapeFill
phone, vibrate, alert, mobile, silent, notify, device - Bootstrap Icons - BsFillPhoneVibrateFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPhoneVibrateFill
printer, print, device, paper, office, document, hardware - Bootstrap Icons - BsFillPrinterFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillPrinterFill
projector, presentation, screen, display, video, device, project - Bootstrap Icons - BsFillProjectorFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillProjectorFill
r, r-circle, letter, alphabet, character, typography, symbol, badge, circle, round, initial, mark, label, tag, ui, button, monogram - Bootstrap Icons - BsFillRCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRCircleFill
r, square, r-square, letter, alphabet, character, symbol, badge, block, initial, mark, label, tag, ui, monogram - Bootstrap Icons - BsFillRSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRSquareFill
reply-all, reply, all, email, message, communication, send-back, response, inbox, forward, arrow, ui-action, thread, conversation - Bootstrap Icons - BsFillReplyAllFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillReplyAllFill
reply, respond, message, email, chat, inbox, arrow, send-back, ui, action, comment, thread - Bootstrap Icons - BsFillReplyFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillReplyFill
router, wifi, network, internet, modem, signal, connect, lan, ethernet, wireless, iot, device, broadband, network-device - Bootstrap Icons - BsFillRouterFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillRouterFill
safe, vault, locker, security, bank, protect, store, secure, lockbox, valuable, money, deposit, strongbox - Bootstrap Icons - BsFillSafeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSafeFill
safe2, safe, vault, locker, security, bank, protect, store, secure, deposit, assets, strongbox - Bootstrap Icons - BsFillSafe2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSafe2Fill
sd, sd-card, memory-card, storage, flash, device, hardware, media, camera-card, portable-storage, data, transfer, backup - Bootstrap Icons - BsFillSdCardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSdCardFill
search, heart, search-heart, love, favorite, find, lookup, discover, romance, wishlist, ui, button, icon, filter, explore, match, results, valentine, social, recommendation, navigation, toolbar, header, mobile - Bootstrap Icons - BsFillSearchHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSearchHeartFill
send, arrow, down, send-arrow-down, download, submit, transfer, message, communication, delivery, forward, downward, ui, button, chat, mail, interaction, upload-alt, workflow - Bootstrap Icons - BsFillSendArrowDownFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSendArrowDownFill
send, arrow, up, send-arrow-up, upload, submit, send-message, forward, chat, mail, communication, transfer, ui, button, interaction, post, message-send - Bootstrap Icons - BsFillSendArrowUpFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSendArrowUpFill
send, check, send-check, delivered, sent, verified, approved, complete, message, communication, status, success, ui, chat, mail, confirmation - Bootstrap Icons - BsFillSendCheckFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSendCheckFill
send, dash, send-dash, pending, unsent, message, delay, communication, status, ui, button, chat, mail, incomplete - Bootstrap Icons - BsFillSendDashFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSendDashFill
send, exclamation, alert, warning, send-exclamation, error, failed, urgent, message, communication, status, ui, chat, mail, attention - Bootstrap Icons - BsFillSendExclamationFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSendExclamationFill
send, send-fill, forward, submit, message, mail, chat, communication, transfer, ui, button, interaction, post - Bootstrap Icons - BsFillSendFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSendFill
send, plus, send-plus, add, new, compose, create-message, mail, chat, communication, forward, submit, ui, interaction - Bootstrap Icons - BsFillSendPlusFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSendPlusFill
send, slash, send-slash, blocked, disabled, restricted, message, communication, prohibited, ui, chat, mail, error - Bootstrap Icons - BsFillSendSlashFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSendSlashFill
send, x, send-x, failed, error, cancel, blocked, unsent, message, communication, ui, chat, mail, warning - Bootstrap Icons - BsFillSendXFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSendXFill
share, share-fill, social-share, send, broadcast, forward, link, post, publish, communication, ui, button, toolbar, distribute - Bootstrap Icons - BsFillShareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillShareFill
shield, security, protect, defense, privacy, guard, secure, safe, auth, ui, system, badge, verified - Bootstrap Icons - BsFillShieldFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillShieldFill
sim, card, sim-card, chip, mobile, network, cellular, telecom, carrier, data, 4g, 5g, device, hardware, slot, communication, connectivity, phone, smartphone - Bootstrap Icons - BsFillSimFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSimFill
sim, slash, sim-slash, no-sim, sim-card, mobile, cellular, network-off, connectivity, disabled, error, warning, alert, blocked, restricted, signal, device, smartphone, gsm, lte, offline, settings, status-icon, ui-indicator - Bootstrap Icons - BsFillSimSlashFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSimSlashFill
slash, forbidden, prohibited, circle, round, blocked, disabled, restricted, no-entry, warning, alert, error, security, symbol, indicator, ui-icon - Bootstrap Icons - BsFillSlashCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSlashCircleFill
slash, square, forbidden, prohibited, blocked, disabled, restricted, no-entry, alert, warning, error, security, ui, symbol - Bootstrap Icons - BsFillSlashSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSlashSquareFill
speaker, audio, sound, volume, loud, media, output, device, music, voice, alert, announcement, notification, speaker-icon, sound-output, media-control - Bootstrap Icons - BsFillSpeakerFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSpeakerFill
star, fill, filled, rating, favorite, bookmark, like, highlight, featured, award, review, rating-star, favorite-button, badge, icon-button, navigation, toolbar, badge-count, ui-element, svg, rating-widget, customer-review, top-pick, highlighted - Bootstrap Icons - BsFillStarFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillStarFill
suit-heart, heart, playing-card, cards, love, favorite, like, health, card-suit, valentine, symbol, filled, svg, badge, wishlist, social-action, icon, emotion - Bootstrap Icons - BsFillSuitHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillSuitHeartFill
tablet, device, mobile, screen, touchscreen, electronics, gadget, smart-device, ipad, android-tablet, responsive, layout, interface, technology, media-device - Bootstrap Icons - BsFillTabletFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTabletFill
tablet, landscape, device, horizontal, screen, touchscreen, electronics, responsive, orientation, media, ipad, android-tablet, layout, interface - Bootstrap Icons - BsFillTabletLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTabletLandscapeFill
telephone, phone, call, contact, landline, communication, dial, ring, call-icon, support, customer-service, helpline, call-center - Bootstrap Icons - BsFillTelephoneFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTelephoneFill
telephone, forward, call-forward, redirect, phone, communication, call, transfer, contact, support, incoming, outgoing - Bootstrap Icons - BsFillTelephoneForwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTelephoneForwardFill
telephone, inbound, incoming-call, phone, communication, customer-support, call-center, contact, ring, call-log, support - Bootstrap Icons - BsFillTelephoneInboundFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTelephoneInboundFill
telephone, minus, remove-call, decline, end-call, communication, dialer, contact, phone-control, call-management - Bootstrap Icons - BsFillTelephoneMinusFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTelephoneMinusFill
telephone, outbound, outgoing-call, dial, call, communication, contact, telecom, customer-support, call-log - Bootstrap Icons - BsFillTelephoneOutboundFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTelephoneOutboundFill
telephone, plus, add-call, start-call, dial, phone, communication, contact, call-management, telecom, support - Bootstrap Icons - BsFillTelephonePlusFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTelephonePlusFill
telephone, x, cancel-call, reject, decline, call-end, phone, communication, contact, call-management - Bootstrap Icons - BsFillTelephoneXFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTelephoneXFill
terminal, console, command-line, cli, developer, coding, programming, shell, bash, code-run, tech, system-tools, debugging, automation - Bootstrap Icons - BsFillTerminalFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTerminalFill
threads, meta, social, chat, conversation, thread, messaging, microblogging, social-app, brand, network, community - Bootstrap Icons - BsFillThreadsFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillThreadsFill
trophy, award, winner, achievement, prize, medal, cup, sports, ranking, celebration, success, goal, badge - Bootstrap Icons - BsFillTrophyFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTrophyFill
tv, television, screen, monitor, display, media, video, entertainment, electronics, device, smart-tv, home, ui - Bootstrap Icons - BsFillTvFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillTvFill
unlock, open-lock, security, access, authentication, permissions, login, key, unlocking, ui, privacy, authorization - Bootstrap Icons - BsFillUnlockFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUnlockFill
usb, usb-c, connector, type-c, port, cable, data-transfer, charging, hardware, device, technology, interface - Bootstrap Icons - BsFillUsbCFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbCFill
usb-drive, flash-drive, pendrive, storage, usb, device, data, file-transfer, backup, hardware, portable-storage - Bootstrap Icons - BsFillUsbDriveFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbDriveFill
usb, connector, port, drive, cable, technology, hardware, data-transfer, charging, device, interface - Bootstrap Icons - BsFillUsbFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbFill
usb, microusb, micro-usb, connector, port, cable, charging, data-transfer, hardware, device, legacy-port - Bootstrap Icons - BsFillUsbMicroFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbMicroFill
usb, mini, usb-mini, port, connector, plug, hardware, device, io, cable, data, transfer, charging, sync, peripheral, electronics, connection, interface, port-type, mobile-accessory, adapter, sidebar, footer, settings, toolbar - Bootstrap Icons - BsFillUsbMiniFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbMiniFill
usb, plug, usb-plug, connector, cable, hardware, device, io, peripheral, charging, sync, data-transfer, power, port, adapter, electronics, connection, wired, settings, toolbar, footer - Bootstrap Icons - BsFillUsbPlugFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillUsbPlugFill
webcam, camera, video, stream, live, record, conference, meeting, call, online-class, monitoring, security-cam, device, hardware, lens, capture, broadcast, chat, video-call, toolbar - Bootstrap Icons - BsFillWebcamFill - SVG | WEBP | PNG | JPG - Icon free download
BsFillWebcamFill
0, zero, circle, filled-circle, number, digit, counter, badge, label, token, step, stage, sequence, round, shape, indicator - Bootstrap Icons - Bs0CircleFill - SVG | WEBP | PNG | JPG - Icon free download
Bs0CircleFill
0, zero, circle, outline-circle, number, digit, numeric, badge, counter, step, stage, round, indicator, token - Bootstrap Icons - Bs0Circle - SVG | WEBP | PNG | JPG - Icon free download
Bs0Circle
0, zero, square, filled-square, digit, number, badge, label, counter, step, block, indicator, token, shape - Bootstrap Icons - Bs0SquareFill - SVG | WEBP | PNG | JPG - Icon free download
Bs0SquareFill
0, zero, square, outline-square, digit, number, badge, counter, step, block, indicator, token, shape - Bootstrap Icons - Bs0Square - SVG | WEBP | PNG | JPG - Icon free download
Bs0Square
1, one, circle, filled-circle, number, digit, counter, badge, label, step, sequence, indicator, round, token - Bootstrap Icons - Bs1CircleFill - SVG | WEBP | PNG | JPG - Icon free download
Bs1CircleFill
1, one, circle, outline-circle, digit, number, badge, counter, step, sequence, indicator, token - Bootstrap Icons - Bs1Circle - SVG | WEBP | PNG | JPG - Icon free download
Bs1Circle
1, one, square, filled-square, digit, number, counter, badge, label, step, block, indicator, token - Bootstrap Icons - Bs1SquareFill - SVG | WEBP | PNG | JPG - Icon free download
Bs1SquareFill
1, one, square, outline-square, digit, number, counter, badge, step, block, indicator, token - Bootstrap Icons - Bs1Square - SVG | WEBP | PNG | JPG - Icon free download
Bs1Square
2, two, circle, filled-circle, digit, number, badge, counter, label, step, round, indicator, sequence, token - Bootstrap Icons - Bs2CircleFill - SVG | WEBP | PNG | JPG - Icon free download
Bs2CircleFill
2, two, circle, outline-circle, digit, number, badge, counter, label, step, indicator, sequence, token - Bootstrap Icons - Bs2Circle - SVG | WEBP | PNG | JPG - Icon free download
Bs2Circle
2, two, square, filled-square, digit, number, badge, counter, step, block, indicator, token, sequence - Bootstrap Icons - Bs2SquareFill - SVG | WEBP | PNG | JPG - Icon free download
Bs2SquareFill
2, two, square, outline-square, digit, number, badge, counter, step, block, indicator, sequence, token - Bootstrap Icons - Bs2Square - SVG | WEBP | PNG | JPG - Icon free download
Bs2Square
3, number-3, digit, circle, circle-fill, round, badge, indicator, label, marker, counter, step, stepper, pagination, ui, button, icon, symbol, shape, rounded, flat, minimal, ios, android - Bootstrap Icons - Bs3CircleFill - SVG | WEBP | PNG | JPG - Icon free download
Bs3CircleFill
3, number-3, digit, circle, circle-outline, round, badge, indicator, hollow-circle, step, stepper, pagination, marker, ui, icon, symbol, shape, minimal, outline-style - Bootstrap Icons - Bs3Circle - SVG | WEBP | PNG | JPG - Icon free download
Bs3Circle
3, number-3, digit, square, square-fill, badge, indicator, label, counter, step, stepper, pagination, marker, ui, icon, shape, block, flat - Bootstrap Icons - Bs3SquareFill - SVG | WEBP | PNG | JPG - Icon free download
Bs3SquareFill
3, number-3, digit, square, square-outline, hollow-square, badge, indicator, label, counter, pagination, step, stepper, ui, icon, shape, outline-style - Bootstrap Icons - Bs3Square - SVG | WEBP | PNG | JPG - Icon free download
Bs3Square
4, number-4, digit, circle, circle-fill, round, badge, indicator, label, marker, counter, step, pagination, stepper, ui, icon, shape, rounded - Bootstrap Icons - Bs4CircleFill - SVG | WEBP | PNG | JPG - Icon free download
Bs4CircleFill
4, number-4, digit, circle, circle-outline, round, hollow-circle, badge, marker, step, stepper, pagination, label, ui, icon, outline-style - Bootstrap Icons - Bs4Circle - SVG | WEBP | PNG | JPG - Icon free download
Bs4Circle
4, number-4, digit, square, square-fill, badge, indicator, counter, label, marker, pagination, step, stepper, ui, icon, shape, block - Bootstrap Icons - Bs4SquareFill - SVG | WEBP | PNG | JPG - Icon free download
Bs4SquareFill
4, number-4, square, shape, box, outline-square, digit, symbol, ui, grid, button, badge, marker, tile, highlight, selection, placeholder, bootstrap, ios, android - Bootstrap Icons - Bs4Square - SVG | WEBP | PNG | JPG - Icon free download
Bs4Square
5, number-5, circle, filled-circle, dot, badge, digit, step, symbol, marker, indicator, round, selection, button, bootstrap, ui - Bootstrap Icons - Bs5CircleFill - SVG | WEBP | PNG | JPG - Icon free download
Bs5CircleFill
5, number-5, circle, outline-circle, digit, badge, marker, indicator, symbol, ui, step, pagination, bootstrap - Bootstrap Icons - Bs5Circle - SVG | WEBP | PNG | JPG - Icon free download
Bs5Circle
5, number-5, square, filled-square, digit, label, tile, badge, marker, symbol, step, pagination, bootstrap - Bootstrap Icons - Bs5SquareFill - SVG | WEBP | PNG | JPG - Icon free download
Bs5SquareFill
5, number-5, square, outline-square, digit, symbol, tile, badge, marker, pagination, step, bootstrap - Bootstrap Icons - Bs5Square - SVG | WEBP | PNG | JPG - Icon free download
Bs5Square
6, number-6, circle, filled-circle, digit, badge, marker, indicator, dot, symbol, bootstrap, step, pagination - Bootstrap Icons - Bs6CircleFill - SVG | WEBP | PNG | JPG - Icon free download
Bs6CircleFill
6, number-6, circle, outline-circle, digit, label, step, badge, indicator, symbol, bootstrap, ui - Bootstrap Icons - Bs6Circle - SVG | WEBP | PNG | JPG - Icon free download
Bs6Circle
6, number-6, square, filled-square, digit, tile, marker, badge, step, symbol, bootstrap, ui - Bootstrap Icons - Bs6SquareFill - SVG | WEBP | PNG | JPG - Icon free download
Bs6SquareFill
6, number-6, square, outline-square, digit, badge, marker, symbol, step, pagination, bootstrap, ui - Bootstrap Icons - Bs6Square - SVG | WEBP | PNG | JPG - Icon free download
Bs6Square
7, number-7, circle, filled-circle, digit, badge, indicator, marker, symbol, pagination, step, bootstrap - Bootstrap Icons - Bs7CircleFill - SVG | WEBP | PNG | JPG - Icon free download
Bs7CircleFill
7, number-7, circle, outline-circle, digit, symbol, marker, badge, step, pagination, bootstrap, ui - Bootstrap Icons - Bs7Circle - SVG | WEBP | PNG | JPG - Icon free download
Bs7Circle
7, number-7, square, filled-square, digit, badge, marker, symbol, step, pagination, tile, bootstrap - Bootstrap Icons - Bs7SquareFill - SVG | WEBP | PNG | JPG - Icon free download
Bs7SquareFill
7, number-7, square, outline-square, digit, label, badge, marker, pagination, step, bootstrap, ui - Bootstrap Icons - Bs7Square - SVG | WEBP | PNG | JPG - Icon free download
Bs7Square
8, number-8, circle, filled-circle, digit, badge, indicator, marker, symbol, step, pagination, bootstrap - Bootstrap Icons - Bs8CircleFill - SVG | WEBP | PNG | JPG - Icon free download
Bs8CircleFill
8, number-8, circle, outline-circle, digit, badge, indicator, symbol, marker, pagination, step, bootstrap, ui - Bootstrap Icons - Bs8Circle - SVG | WEBP | PNG | JPG - Icon free download
Bs8Circle
8, eight, number, digit, square, 8-square, numeric, counter, label, tile, box, ui, badge, button, grid, layout - Bootstrap Icons - Bs8SquareFill - SVG | WEBP | PNG | JPG - Icon free download
Bs8SquareFill
9, nine, number, digit, circle, 9-circle, filled, numeric, counter, label, dot, badge, indicator - Bootstrap Icons - Bs9CircleFill - SVG | WEBP | PNG | JPG - Icon free download
Bs9CircleFill
9, nine, number, digit, square, 9-square, filled, numeric, counter, label, tile, badge - Bootstrap Icons - Bs9SquareFill - SVG | WEBP | PNG | JPG - Icon free download
Bs9SquareFill
alexa, amazon, voice, voice-assistant, smart, smart-home, iot, brand, speaker, assistant, ai, command - Bootstrap Icons - BsAlexa - SVG | WEBP | PNG | JPG - Icon free download
BsAlexa
alipay, brand, payment, wallet, china, alibaba, finance, checkout, transaction, online-payment, digital-wallet, qr-payment, ecommerce, mobile-payment, gateway - Bootstrap Icons - BsAlipay - SVG | WEBP | PNG | JPG - Icon free download
BsAlipay
amazon, brand, shopping, ecommerce, retail, marketplace, aws, store, online-shop, cart, prime - Bootstrap Icons - BsAmazon - SVG | WEBP | PNG | JPG - Icon free download
BsAmazon
amd, brand, processor, cpu, gpu, hardware, chip, computing, tech, electronics, ryzen, radeon, semiconductor - Bootstrap Icons - BsAmd - SVG | WEBP | PNG | JPG - Icon free download
BsAmd
android, brand, google, mobile, os, smartphone, development, app, robot, platform, mobile-app - Bootstrap Icons - BsAndroid - SVG | WEBP | PNG | JPG - Icon free download
BsAndroid
android, android2, brand, mobile, os, google, smartphone, app-platform, development, robot, tech - Bootstrap Icons - BsAndroid2 - SVG | WEBP | PNG | JPG - Icon free download
BsAndroid2
app, indicator, app-indicator, notification, status, dot, badge, alert, menu-bar, taskbar, launcher, system-ui - Bootstrap Icons - BsAppIndicator - SVG | WEBP | PNG | JPG - Icon free download
BsAppIndicator
app, application, software, program, mobile-app, desktop-app, launcher, menu, platform, icon, grid - Bootstrap Icons - BsApp - SVG | WEBP | PNG | JPG - Icon free download
BsApp
apple, ios, mac, macos, iphone, brand, tech, hardware, company, device, store, app-store - Bootstrap Icons - BsApple - SVG | WEBP | PNG | JPG - Icon free download
BsApple
at, email, address, contact, symbol, username, handle, typography, communication, mention - Bootstrap Icons - BsAt - SVG | WEBP | PNG | JPG - Icon free download
BsAt
award, medal, trophy, achievement, badge, reward, certificate, filled, success, win, recognition - Bootstrap Icons - BsAwardFill - SVG | WEBP | PNG | JPG - Icon free download
BsAwardFill
award, medal, trophy, achievement, badge, reward, outline, success, recognition, certificate - Bootstrap Icons - BsAward - SVG | WEBP | PNG | JPG - Icon free download
BsAward
badge, 3d, three-dimensional, filled, video, media, sticker, label, tag, display, resolution, quality, banner, promo, card - Bootstrap Icons - BsBadge3dFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadge3dFill
badge, 3d, three-dimensional, outline, media, video, label, tag, sticker, resolution, quality, display, promo - Bootstrap Icons - BsBadge3D - SVG | WEBP | PNG | JPG - Icon free download
BsBadge3D
badge, 4k, ultra-hd, uhd, video, resolution, quality, media, display, label, sticker, promo, filled - Bootstrap Icons - BsBadge4kFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadge4kFill
badge, 4k, ultra-hd, uhd, resolution, video, media, display, tag, label, sticker, quality, outline - Bootstrap Icons - BsBadge4K - SVG | WEBP | PNG | JPG - Icon free download
BsBadge4K
badge, 8k, ultra-hd, uhd, super-high-resolution, video, media, display, quality, label, sticker, promo, filled - Bootstrap Icons - BsBadge8kFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadge8kFill
badge, 8k, ultra-hd, uhd, video, resolution, media, quality, display, sticker, tag, outline - Bootstrap Icons - BsBadge8K - SVG | WEBP | PNG | JPG - Icon free download
BsBadge8K
badge, ad, advertisement, ads, promo, marketing, branding, banner, label, sticker, filled, tag, campaign, highlight - Bootstrap Icons - BsBadgeAdFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeAdFill
badge, ad, advertisement, promo, promotion, marketing, label, tag, ui, interface, outline, sticker, banner, chip, badge-icon, header, footer, sidebar, button, indicator, marketing-tag, ad-label - Bootstrap Icons - BsBadgeAd - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeAd
badge, ar, audio, recording, augmented, subtitle, language, label, tag, filled, chip, ui, interface, sticker, indicator, media, caption, badge-ar, audio-tag - Bootstrap Icons - BsBadgeArFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeArFill
badge, ar, audio, recording, augmented, subtitle, outline, label, tag, chip, ui, interface, media, caption, indicator, sticker, badge-ar, audio-label - Bootstrap Icons - BsBadgeAr - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeAr
badge, cc, closed-captions, captions, subtitle, filled, label, tag, media, video, audio, accessibility, cc-badge, captioning, interface, sticker, indicator, cc-label - Bootstrap Icons - BsBadgeCcFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeCcFill
badge, cc, closed-captions, captions, subtitle, outline, media, accessibility, video, audio, label, tag, sticker, chip, indicator, player, cc-icon - Bootstrap Icons - BsBadgeCc - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeCc
badge, hd, high-definition, video, quality, filled, label, tag, media, display, resolution, streaming, hd-icon, indicator, player, ui - Bootstrap Icons - BsBadgeHdFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeHdFill
badge, hd, high-definition, outline, video, quality, media, streaming, resolution, display, label, tag, indicator, player, hd-icon - Bootstrap Icons - BsBadgeHd - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeHd
badge, sd, standard-definition, filled, video, quality, media, resolution, display, streaming, label, tag, indicator, player, sd-icon - Bootstrap Icons - BsBadgeSdFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeSdFill
badge, sd, standard-definition, outline, video, quality, media, streaming, resolution, display, label, tag, indicator, player, sd-label - Bootstrap Icons - BsBadgeSd - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeSd
badge, tm, trademark, filled, legal, brand, ip, label, tag, sticker, chip, interface, logo, mark, tm-icon, indicator - Bootstrap Icons - BsBadgeTmFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeTmFill
badge, tm, trademark, outline, legal, brand, ip, label, tag, chip, sticker, logo, indicator, tm-mark, branding - Bootstrap Icons - BsBadgeTm - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeTm
badge, vo, voice-over, filled, audio, video, subtitle, caption, label, tag, media, interface, indicator, vo-tag, voice, recording - Bootstrap Icons - BsBadgeVoFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeVoFill
badge, vo, voice-over, outline, audio, video, subtitle, caption, media, label, tag, indicator, vo-icon, voice, record - Bootstrap Icons - BsBadgeVo - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeVo
badge, vr, virtual-reality, filled, gaming, technology, media, immersive, label, tag, interface, vr-icon, headset, 3d, indicator - Bootstrap Icons - BsBadgeVrFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeVrFill
badge, vr, virtual-reality, outline, gaming, immersive, technology, media, label, tag, vr-icon, interface, 3d, indicator, vr-badge - Bootstrap Icons - BsBadgeVr - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeVr
badge, wc, washroom, restroom, toilet, filled, label, tag, public, facility, signage, bathroom, indicator, interface, wc-icon, wayfinding - Bootstrap Icons - BsBadgeWcFill - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeWcFill
badge, wc, washroom, restroom, toilet, outline, signage, public, facility, label, tag, wayfinding, bathroom, indicator, interface - Bootstrap Icons - BsBadgeWc - SVG | WEBP | PNG | JPG - Icon free download
BsBadgeWc
bag, shopping-bag, bag-fill, purchase, cart, checkout, add-to-cart, product, store, shop, retail, gift-bag, header, nav, button, icon-button, badge, active, material, bootstrap, ecommerce-icon, ui, ux, mobile, web - Bootstrap Icons - BsBagFill - SVG | WEBP | PNG | JPG - Icon free download
BsBagFill
bag, heart, bag-heart, favorite, wishlist, like, saved-item, shopping, retail, purchase, store, product, collection, user-action, cta, button, badge, mobile, web, bootstrap, ui - Bootstrap Icons - BsBagHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsBagHeartFill
bag, heart, bag-heart, wishlist, favorite, like, save, shopping, store, product, retail, outline, button, nav, header, ui, web, mobile, bootstrap - Bootstrap Icons - BsBagHeart - SVG | WEBP | PNG | JPG - Icon free download
BsBagHeart
bag, plus, add, bag-plus, add-to-cart, create-order, purchase, buy, cart, cta, button, badge, product, store, retail, mobile, web, bootstrap, ui, ux - Bootstrap Icons - BsBagPlusFill - SVG | WEBP | PNG | JPG - Icon free download
BsBagPlusFill
bag, plus, bag-plus, add, add-to-cart, purchase, buy, cart, outline, button, nav, header, ui, mobile, web, bootstrap - Bootstrap Icons - BsBagPlus - SVG | WEBP | PNG | JPG - Icon free download
BsBagPlus
bag, x, remove, bag-x, remove-from-cart, delete, cancel, undo-purchase, refund, cart, button, cta, badge, mobile, web, bootstrap, ui - Bootstrap Icons - BsBagXFill - SVG | WEBP | PNG | JPG - Icon free download
BsBagXFill
bag, x, remove, bag-x, delete, remove-from-cart, cancel, outline, button, nav, header, ui, mobile, web, bootstrap - Bootstrap Icons - BsBagX - SVG | WEBP | PNG | JPG - Icon free download
BsBagX
bag, shopping-bag, store, shop, retail, purchase, product, cart, outline, button, nav, header, ui, ux, mobile, web, bootstrap - Bootstrap Icons - BsBag - SVG | WEBP | PNG | JPG - Icon free download
BsBag
balloon, party, celebration, festive, event, decoration, filled, birthday, anniversary, congrats, notification, badge, promo, hero, illustration, ui, web, mobile, bootstrap - Bootstrap Icons - BsBalloonFill - SVG | WEBP | PNG | JPG - Icon free download
BsBalloonFill
balloon, heart, love, romance, valentines, filled, event, celebration, greeting, anniversary, wedding, promo, badge, ui, mobile, web, bootstrap - Bootstrap Icons - BsBalloonHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsBalloonHeartFill
balloon, heart, balloon-heart, outline, love, romance, valentines, wedding, greeting, event, celebration, badge, ui, mobile, web, bootstrap - Bootstrap Icons - BsBalloonHeart - SVG | WEBP | PNG | JPG - Icon free download
BsBalloonHeart
balloon, party, celebration, event, outline, decoration, birthday, anniversary, promo, badge, ui, web, mobile, bootstrap - Bootstrap Icons - BsBalloon - SVG | WEBP | PNG | JPG - Icon free download
BsBalloon
ban, prohibit, forbidden, block, no-entry, disabled, filled, error, stop, access-denied, restriction, alert, badge, button, ui, web, mobile, bootstrap - Bootstrap Icons - BsBanFill - SVG | WEBP | PNG | JPG - Icon free download
BsBanFill
ban, forbidden, prohibit, block, no-entry, outline, disabled, error, stop, access-denied, restriction, alert, button, ui, web, mobile, bootstrap - Bootstrap Icons - BsBan - SVG | WEBP | PNG | JPG - Icon free download
BsBan
bandaid, bandage, first-aid, heal, medical, health, wound, care, filled, clinic, hospital, treatment, support, icon, ui, mobile, web, bootstrap - Bootstrap Icons - BsBandaidFill - SVG | WEBP | PNG | JPG - Icon free download
BsBandaidFill
bandaid, bandage, first-aid, medical, health, wound, care, outline, clinic, hospital, treatment, support, ui, web, mobile, bootstrap - Bootstrap Icons - BsBandaid - SVG | WEBP | PNG | JPG - Icon free download
BsBandaid
bank, institution, banking, finance, building, branch, money, payment, loans, savings, accounts, outline, corporate, dashboard, ui, web, mobile, bootstrap - Bootstrap Icons - BsBank - SVG | WEBP | PNG | JPG - Icon free download
BsBank
bank, bank-2, institution, finance, money, savings, accounts, loans, outline, branch, payment, dashboard, ui, web, mobile, bootstrap - Bootstrap Icons - BsBank2 - SVG | WEBP | PNG | JPG - Icon free download
BsBank2
bar, chart, barchart, bar-chart, analytics, data, statistics, reports, dashboard, filled, visualization, metrics, performance, insights, ui, web, mobile, bootstrap - Bootstrap Icons - BsBarChartFill - SVG | WEBP | PNG | JPG - Icon free download
BsBarChartFill
bar, chart, line, bar-chart-line, analytics, data, statistics, trend, reports, dashboard, filled, visualization, metrics, insights, ui, web, mobile, bootstrap - Bootstrap Icons - BsBarChartLineFill - SVG | WEBP | PNG | JPG - Icon free download
BsBarChartLineFill
bar, chart, line, bar-chart-line, analytics, data, statistics, trend, reports, dashboard, outline, visualization, metrics, insights, ui, web, mobile, bootstrap - Bootstrap Icons - BsBarChartLine - SVG | WEBP | PNG | JPG - Icon free download
BsBarChartLine
bar, chart, steps, bar-chart-steps, analytics, progress, milestones, statistics, dashboard, outline, visualization, metrics, ui, web, mobile, bootstrap - Bootstrap Icons - BsBarChartSteps - SVG | WEBP | PNG | JPG - Icon free download
BsBarChartSteps
bar, chart, bar-chart, analytics, data, statistics, reports, dashboard, outline, visualization, metrics, performance, insights, ui, web, mobile, bootstrap - Bootstrap Icons - BsBarChart - SVG | WEBP | PNG | JPG - Icon free download
BsBarChart
basket, shopping-basket, basket-fill, cart, checkout, purchase, store, retail, product, add-to-cart, button, badge, ui, web, mobile, bootstrap - Bootstrap Icons - BsBasketFill - SVG | WEBP | PNG | JPG - Icon free download
BsBasketFill
battery, charging, power, charge, electric, energy, device, low-power, high-power, status, indicator, system, electronics, hardware, lightning, ui, toolbar - Bootstrap Icons - BsBatteryCharging - SVG | WEBP | PNG | JPG - Icon free download
BsBatteryCharging
battery, full, charged, power, energy, device, system, indicator, high-battery, hardware, ui, toolbar, status - Bootstrap Icons - BsBatteryFull - SVG | WEBP | PNG | JPG - Icon free download
BsBatteryFull
battery, half, medium, charge, power, energy, device, indicator, system, hardware, ui, toolbar - Bootstrap Icons - BsBatteryHalf - SVG | WEBP | PNG | JPG - Icon free download
BsBatteryHalf
battery, power, charge, energy, device, system, indicator, hardware, status, toolbar, outline - Bootstrap Icons - BsBattery - SVG | WEBP | PNG | JPG - Icon free download
BsBattery
behance, brand, logo, social, portfolio, designers, creative, network, brand-icon, dribbble-alt, ui, link, share, button - Bootstrap Icons - BsBehance - SVG | WEBP | PNG | JPG - Icon free download
BsBehance
bell, notification, alert, filled, ring, reminder, ping, sound, notify, message, alarm, ui, toolbar, header, badge - Bootstrap Icons - BsBellFill - SVG | WEBP | PNG | JPG - Icon free download
BsBellFill
bell, notification, alert, ring, reminder, ping, sound, notify, ui, toolbar, menu, badge, outline - Bootstrap Icons - BsBell - SVG | WEBP | PNG | JPG - Icon free download
BsBell
bing, brand, search, engine, microsoft, web, internet, seo, query, lookup, browser, logo, branding, ui, navigation - Bootstrap Icons - BsBing - SVG | WEBP | PNG | JPG - Icon free download
BsBing
bluetooth, wireless, connection, pair, device, network, mobile, tech, signal, connect, iot, transfer, communication, ui - Bootstrap Icons - BsBluetooth - SVG | WEBP | PNG | JPG - Icon free download
BsBluetooth
bookmark, star, bookmark-star, favorite, save, saved, highlight, reading-list, collection, marker, pin, button, toggle, active, hover, badge, header, sidebar, card, bootstrap, react-icons, filled, ui-icon, mobile, web - Bootstrap Icons - BsBookmarkStarFill - SVG | WEBP | PNG | JPG - Icon free download
BsBookmarkStarFill
bookmark, star, bookmark-star, favorite, save, reading-list, outline, unfilled, toggle, action, button, header, sidebar, card, marker, pin, bootstrap, react-icons, web, mobile, accessibility - Bootstrap Icons - BsBookmarkStar - SVG | WEBP | PNG | JPG - Icon free download
BsBookmarkStar
bookmark, x, close, remove, delete, bookmark-x, unfavorite, unsave, filled, cta, button, list, reading-list, card, sidebar, header, bootstrap, react-icons, mobile, web, interaction - Bootstrap Icons - BsBookmarkXFill - SVG | WEBP | PNG | JPG - Icon free download
BsBookmarkXFill
bookmark, x, close, remove, delete, bookmark-x, unsave, outline, toggle, button, list, reading-list, card, sidebar, header, bootstrap, react-icons, mobile, web - Bootstrap Icons - BsBookmarkX - SVG | WEBP | PNG | JPG - Icon free download
BsBookmarkX
bookmark, save, reading, reading-list, outline, marker, pin, favorite, toggle, button, card, sidebar, header, bookmarklet, bootstrap, react-icons, web, mobile, accessibility - Bootstrap Icons - BsBookmark - SVG | WEBP | PNG | JPG - Icon free download
BsBookmark
bookmarks, multiple, collection, folder, library, saved, filled, reading-list, organize, bookmark-collection, button, menu, sidebar, dashboard, card, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBookmarksFill - SVG | WEBP | PNG | JPG - Icon free download
BsBookmarksFill
bookmarks, collection, multiple, library, outline, saved, reading-list, organize, bookmark-collection, menu, sidebar, dashboard, card, button, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBookmarks - SVG | WEBP | PNG | JPG - Icon free download
BsBookmarks
bookshelf, shelf, library, books, collection, reading, archive, catalog, media, education, knowledge, outline, menu, library-page, dashboard, card, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBookshelf - SVG | WEBP | PNG | JPG - Icon free download
BsBookshelf
boombox, music, audio, stereo, speaker, retro, playback, media-player, filled, album, playlist, dj, sound, entertainment, button, toolbar, card, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBoomboxFill - SVG | WEBP | PNG | JPG - Icon free download
BsBoomboxFill
boombox, music, audio, stereo, speaker, retro, player, outline, media-player, playlist, sound, entertainment, button, toolbar, card, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBoombox - SVG | WEBP | PNG | JPG - Icon free download
BsBoombox
bootstrap, logo, brand, framework, css, ui-kit, filled, badge, tech, frontend, library, developer, react-icons, web, branding, icon, marketing - Bootstrap Icons - BsBootstrapFill - SVG | WEBP | PNG | JPG - Icon free download
BsBootstrapFill
bootstrap, reboot, logo, brand, css-reset, framework, developer, tooling, settings, badge, react-icons, web, frontend, documentation, icon - Bootstrap Icons - BsBootstrapReboot - SVG | WEBP | PNG | JPG - Icon free download
BsBootstrapReboot
bootstrap, logo, brand, framework, css, ui-kit, frontend, developer, library, badge, react-icons, web, icon, branding - Bootstrap Icons - BsBootstrap - SVG | WEBP | PNG | JPG - Icon free download
BsBootstrap
border, all, grid, table, cells, layout, outline, box, frame, table-border, editor, formatting, toolbar, button, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderAll - SVG | WEBP | PNG | JPG - Icon free download
BsBorderAll
border, bottom, underline, table, row, cells, formatting, layout, box, frame, editor, toolbar, button, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderBottom - SVG | WEBP | PNG | JPG - Icon free download
BsBorderBottom
border, center, alignment, grid, cells, formatting, layout, table, editor, toolbar, button, align-center, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderCenter - SVG | WEBP | PNG | JPG - Icon free download
BsBorderCenter
border, inner, grid, cells, table, layout, formatting, editor, frame, box, toolbar, button, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderInner - SVG | WEBP | PNG | JPG - Icon free download
BsBorderInner
border, left, alignment, table, column, cells, formatting, layout, editor, toolbar, button, align-left, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderLeft - SVG | WEBP | PNG | JPG - Icon free download
BsBorderLeft
border, middle, center, grid, cells, table, layout, formatting, editor, toolbar, button, align-center, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderMiddle - SVG | WEBP | PNG | JPG - Icon free download
BsBorderMiddle
border, outer, frame, box, container, layout, table, cells, formatting, editor, toolbar, button, bootstrap, react-icons, web, mobile - Bootstrap Icons - BsBorderOuter - SVG | WEBP | PNG | JPG - Icon free download
BsBorderOuter
border, style, border-style, dotted, dashed, solid, css, ui, layout, stroke, outline, editor, styling, design-tool, formating, button, hover, panel, toolbar, web, mobile - Bootstrap Icons - BsBorderStyle - SVG | WEBP | PNG | JPG - Icon free download
BsBorderStyle
border, top, border-top, layout, css, frame, outline, stroke, alignment, editor, design, ui, toolbar, panel, hover, button, web, mobile - Bootstrap Icons - BsBorderTop - SVG | WEBP | PNG | JPG - Icon free download
BsBorderTop
briefcase, work, job, career, office, business, portfolio, professional, employment, documents, business-tools, task, corporate - Bootstrap Icons - BsBriefcaseFill - SVG | WEBP | PNG | JPG - Icon free download
BsBriefcaseFill
briefcase, work, job, career, office, business, portfolio, professional, employment, documents, task, corporate - Bootstrap Icons - BsBriefcase - SVG | WEBP | PNG | JPG - Icon free download
BsBriefcase
chrome, google-chrome, browser, web, internet, brand, google, software, web-browser, application, ui, logo - Bootstrap Icons - BsBrowserChrome - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserChrome
edge, microsoft-edge, browser, web, internet, brand, microsoft, software, web-browser, logo, application - Bootstrap Icons - BsBrowserEdge - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserEdge
browser, firefox, mozilla, web, internet, tabs, navigation, search, engine, homepage, ui, toolbar, app, software, window, web-app, bookmark, address-bar, security, open-source, brand - Bootstrap Icons - BsBrowserFirefox - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserFirefox
browser, safari, apple, apple-browser, web, internet, search, engine, navigation, tabs, bookmark, ui, toolbar, macos, ios, window, web-app, address-bar, brand - Bootstrap Icons - BsBrowserSafari - SVG | WEBP | PNG | JPG - Icon free download
BsBrowserSafari
bug, error, issue, debug, filled-bug, test, qa, defect, malware, security, alert, warning, devtools, inspection, problem - Bootstrap Icons - BsBugFill - SVG | WEBP | PNG | JPG - Icon free download
BsBugFill
bug, debug, issue, error, outline-bug, defect, malware, security, alert, devtools, qa, inspection, problem - Bootstrap Icons - BsBug - SVG | WEBP | PNG | JPG - Icon free download
BsBug
building, lock, security, filled-building, access, restricted, property, infrastructure, office, safety - Bootstrap Icons - BsBuildingFillLock - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFillLock
building, office, tower, skyscraper, city, structure, real-estate, property, headquarters, enterprise, company, location, map, urban, infrastructure, block, complex, estate, landmark, navigation, ui, header, sidebar, button - Bootstrap Icons - BsBuildingFill - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingFill
building, lock, secure-building, restricted, access, protection, security, privacy, authorization, gatekeeping, property-security, office-lock, facility, restricted-area, safe, guardian, secure-access - Bootstrap Icons - BsBuildingLock - SVG | WEBP | PNG | JPG - Icon free download
BsBuildingLock
building, office, tower, structure, city, urban, company, real-estate, property, location, map, landmark, enterprise, infrastructure, estate, headquarters - Bootstrap Icons - BsBuilding - SVG | WEBP | PNG | JPG - Icon free download
BsBuilding
c, letter-c, circle, c-circle, alphabet, character, initial, mark, badge, label, tag, symbol, typography, icon-letter, round, ui - Bootstrap Icons - BsCCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsCCircleFill
c, letter-c, circle, c-circle, alphabet, character, initial, mark, badge, outline, symbol, typography, label, tag, ui, round - Bootstrap Icons - BsCCircle - SVG | WEBP | PNG | JPG - Icon free download
BsCCircle
c, letter-c, square, c-square, alphabet, character, initial, badge, label, symbol, typography, flat, block, tag, ui - Bootstrap Icons - BsCSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsCSquareFill
c, letter-c, square, c-square, alphabet, character, initial, symbol, outline, badge, label, typography, tag, block, ui - Bootstrap Icons - BsCSquare - SVG | WEBP | PNG | JPG - Icon free download
BsCSquare
camera, camera-fill, photo, photography, capture, shoot, picture, image, media, gallery, content, record, focus, lens, snapshot, upload, ui, mobile, toolbar, button - Bootstrap Icons - BsCameraFill - SVG | WEBP | PNG | JPG - Icon free download
BsCameraFill
cast, screen-cast, stream, streaming, connect, wireless, airplay, chromecast, mirroring, display, device, tv-out, multimedia, presentation, wifi, project - Bootstrap Icons - BsCast - SVG | WEBP | PNG | JPG - Icon free download
BsCast
chat, dots, chat-dots, message, typing, conversation, bubble, speech, support, reply, comment, communication, social, dm, inbox, thread, messenger - Bootstrap Icons - BsChatDotsFill - SVG | WEBP | PNG | JPG - Icon free download
BsChatDotsFill
chat, left, quote, fill, chat-left, chat-quote, speech, bubble, dialogue, conversation, reply, message, quoted-message, feedback, comment, support, helpdesk, chat-ui, sms, messenger, communication, inbox, thread, ios, android, sidebar, toolbar-icon, bubble-left, text-bubble, customer-support, qa - Bootstrap Icons - BsChatLeftQuoteFill - SVG | WEBP | PNG | JPG - Icon free download
BsChatLeftQuoteFill
chat, right, chat-right, message, bubble, speech, talk, conversation, reply, inbox, support, comment, thread, dialog, interface, ui, messaging, social, communication, chatbox, sidebar, header, footer, android, ios, web - Bootstrap Icons - BsChatRight - SVG | WEBP | PNG | JPG - Icon free download
BsChatRight
chat, square, dots, typing, chat-square-dots, filled, bubble, message, typing-indicator, conversation, comment, reply, support, messaging, chatbox, indicator, ui, web, android, ios - Bootstrap Icons - BsChatSquareDotsFill - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquareDotsFill
chat, square, dots, typing, chat-square-dots, message, typing-indicator, conversation, bubble, comment, reply, support, ui, interface, messaging, thread - Bootstrap Icons - BsChatSquareDots - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquareDots
chat, square, filled, chat-square, message, bubble, comment, reply, conversation, messaging, ui, interface, support, thread - Bootstrap Icons - BsChatSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquareFill
chat, square, heart, filled, chat-square-heart, love, like, favorite, reaction, social, comment, message, bubble, ui, messaging, engagement, feedback - Bootstrap Icons - BsChatSquareHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquareHeartFill
chat, square, heart, chat-square-heart, love, like, favorite, reaction, message, bubble, comment, social, engagement, ui, messaging - Bootstrap Icons - BsChatSquareHeart - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquareHeart
chat, square, quote, filled, chat-square-quote, quotation, reply, message, bubble, comment, thread, response, ui, messaging, conversation - Bootstrap Icons - BsChatSquareQuoteFill - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquareQuoteFill
chat, square, quote, chat-square-quote, quotation, bubble, message, reply, thread, comment, conversation, ui, messaging - Bootstrap Icons - BsChatSquareQuote - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquareQuote
chat, square, text, filled, chat-square-text, message, text-bubble, comment, reply, conversation, typing, ui, messaging, thread - Bootstrap Icons - BsChatSquareTextFill - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquareTextFill
chat, square, text, chat-square-text, message, comment, reply, conversation, text-bubble, ui, messaging, thread - Bootstrap Icons - BsChatSquareText - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquareText
chat, square, chat-square, message, bubble, comment, reply, conversation, ui, messaging, support, thread - Bootstrap Icons - BsChatSquare - SVG | WEBP | PNG | JPG - Icon free download
BsChatSquare
chat, text, filled, chat-text, bubble, message, comment, reply, typing, conversation, ui, messaging, support - Bootstrap Icons - BsChatTextFill - SVG | WEBP | PNG | JPG - Icon free download
BsChatTextFill
chat, text, chat-text, bubble, message, comment, reply, typing, conversation, ui, messaging, support - Bootstrap Icons - BsChatText - SVG | WEBP | PNG | JPG - Icon free download
BsChatText
chat, bubble, message, comment, conversation, reply, ui, messaging, support, thread, speech, talk, dialog - Bootstrap Icons - BsChat - SVG | WEBP | PNG | JPG - Icon free download
BsChat
check, circle, tick, success, completed, approved, status, badge, indicator, confirm, ui, button, label, verified, positive, ios, android - Bootstrap Icons - BsCheck2Circle - SVG | WEBP | PNG | JPG - Icon free download
BsCheck2Circle
circle, square, shape, circle-square, geometric, mix, badge, indicator, design, ui, minimal, web - Bootstrap Icons - BsCircleSquare - SVG | WEBP | PNG | JPG - Icon free download
BsCircleSquare
controller, gamepad, gaming, console, joystick, play, video-game, entertainment, device, esports, arcade, ui, button, menu, interaction - Bootstrap Icons - BsController - SVG | WEBP | PNG | JPG - Icon free download
BsController
cpu, processor, chip, hardware, computer, technology, filled, performance, system, server, core, electronics, monitoring, diagnostics, iot, device - Bootstrap Icons - BsCpuFill - SVG | WEBP | PNG | JPG - Icon free download
BsCpuFill
cpu, processor, chip, hardware, computer, technology, outline, system, performance, core, server, iot, diagnostics, device, monitoring - Bootstrap Icons - BsCpu - SVG | WEBP | PNG | JPG - Icon free download
BsCpu
database, lock, secure, security, privacy, protect, restricted, encrypted, auth, authorization, server, backend, sql, nosql, data-store, compliance, safe, confidential - Bootstrap Icons - BsDatabaseFillLock - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseFillLock
database, lock, secure, restricted, security, privacy, auth, authorization, encrypted, server, backend, sql, nosql, data-store, protection, safe, compliance - Bootstrap Icons - BsDatabaseLock - SVG | WEBP | PNG | JPG - Icon free download
BsDatabaseLock
device, hdd, hard-disk, drive, storage, hardware, backup, disk, file-system, local-storage, server, data, io, performance, tech, filled - Bootstrap Icons - BsDeviceHddFill - SVG | WEBP | PNG | JPG - Icon free download
BsDeviceHddFill
device, hdd, hard-disk, disk, drive, storage, local-storage, hardware, backup, server, io, tech, thin-line - Bootstrap Icons - BsDeviceHdd - SVG | WEBP | PNG | JPG - Icon free download
BsDeviceHdd
ssd, solid-state-drive, storage, device, drive, disk, hardware, performance, fast-storage, tech, filled, system, file-system, memory - Bootstrap Icons - BsDeviceSsdFill - SVG | WEBP | PNG | JPG - Icon free download
BsDeviceSsdFill
ssd, solid-state-drive, storage, hardware, device, drive, disk, performance, fast-storage, thin-line, settings, system, memory - Bootstrap Icons - BsDeviceSsd - SVG | WEBP | PNG | JPG - Icon free download
BsDeviceSsd
diamond, shape, rhombus, gem, symbol, filled, ui, badge, indicator, graphic, geometry, decoration - Bootstrap Icons - BsDiamondFill - SVG | WEBP | PNG | JPG - Icon free download
BsDiamondFill
discord, brand, logo, chat, community, server, gaming, voice-chat, text-chat, social, communication, online, messaging, group, guild, platform, app, icon, android, ios, web - Bootstrap Icons - BsDiscord - SVG | WEBP | PNG | JPG - Icon free download
BsDiscord
display, monitor, screen, desktop, pc, computer, filled, device, hardware, workstation, ui, presentation, preview, layout, dashboard, web, ios, android - Bootstrap Icons - BsDisplayFill - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayFill
display, monitor, screen, desktop, outline, pc, computer, device, hardware, workspace, dashboard, preview, ui, web, minimal, android, ios - Bootstrap Icons - BsDisplay - SVG | WEBP | PNG | JPG - Icon free download
BsDisplay
displayport, port, connector, filled, cable, video-output, monitor, screen, hardware, device, pc, laptop, input-output, tech, ui, web - Bootstrap Icons - BsDisplayportFill - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayportFill
displayport, port, connector, outline, video-output, monitor, hardware, pc, laptop, screen, device, tech, wire, cable, ui, web, ios, android - Bootstrap Icons - BsDisplayport - SVG | WEBP | PNG | JPG - Icon free download
BsDisplayport
door, closed, lock, entry, exit, filled, home, house, room, office, building, security, access, restricted, private, symbol, ui, web, android, ios - Bootstrap Icons - BsDoorClosedFill - SVG | WEBP | PNG | JPG - Icon free download
BsDoorClosedFill
door, closed, outline, entry, exit, home, office, security, private, restricted, room, building, access, state, symbol, ui, web, ios, android - Bootstrap Icons - BsDoorClosed - SVG | WEBP | PNG | JPG - Icon free download
BsDoorClosed
dot, point, bullet, indicator, status, marker, minimal, tiny, ui, list, item, separator, symbol, badge, highlight, cursor, android, ios, web - Bootstrap Icons - BsDot - SVG | WEBP | PNG | JPG - Icon free download
BsDot
dribbble, brand, logo, social, social-media, design, designer-community, portfolio, networking, web, ui, ux, creative, community, platform, branding, marketing - Bootstrap Icons - BsDribbble - SVG | WEBP | PNG | JPG - Icon free download
BsDribbble
dropbox, cloud, cloud-storage, files, file-sharing, sync, backup, brand, logo, folder, document, collaboration, teamwork, storage-service - Bootstrap Icons - BsDropbox - SVG | WEBP | PNG | JPG - Icon free download
BsDropbox
earbuds, earphones, headphones, audio, music, sound, listen, media, device, portable-audio, wireless, wired, stereo, entertainment - Bootstrap Icons - BsEarbuds - SVG | WEBP | PNG | JPG - Icon free download
BsEarbuds
eject, eject-fill, media, control, player, audio, video, dvd, cd, remove, unmount, hardware, device, button, toolbar, ui, ios, android, web, playback, action, triangle, upward, system-control - Bootstrap Icons - BsEjectFill - SVG | WEBP | PNG | JPG - Icon free download
BsEjectFill
envelope, mail, email, arrow-down, download-mail, incoming, inbox, message, receive, communication, delivery, letter, notification, bootstrap - Bootstrap Icons - BsEnvelopeArrowDownFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeArrowDownFill
envelope, email, incoming, arrow-down, outline, receive, mail, letter, message, download, inbox, notification - Bootstrap Icons - BsEnvelopeArrowDown - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeArrowDown
envelope, email, arrow-up, send, upload-mail, outgoing, message, mail, letter, communication, delivery, notification - Bootstrap Icons - BsEnvelopeArrowUpFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeArrowUpFill
envelope, email, arrow-up, send, outgoing, outline, message, letter, communication, upload, deliver, notification - Bootstrap Icons - BsEnvelopeArrowUp - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeArrowUp
envelope, mail, email, at, address, message, contact, send, inbox, outbox, communication, reply, compose, newsletter, filled, ui, icon, header, footer, sidebar, button, badge - Bootstrap Icons - BsEnvelopeAtFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeAtFill
envelope, mail, email, at, address, message, contact, outline, send, communication, newsletter, reply, ui, button, icon, navigation - Bootstrap Icons - BsEnvelopeAt - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeAt
envelope, mail, email, check, verified, success, approved, message, read, completed, task, filled, ui, badge, inbox, notification - Bootstrap Icons - BsEnvelopeCheckFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeCheckFill
envelope, mail, email, check, verified, success, approved, message, outline, read, completed, task, notification, ui - Bootstrap Icons - BsEnvelopeCheck - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeCheck
envelope, mail, email, dash, minus, remove, blocked, restricted, message, alert, filled, warning, ui, notification - Bootstrap Icons - BsEnvelopeDashFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeDashFill
envelope, mail, email, dash, minus, blocked, remove, restricted, message, alert, outline, notification, ui - Bootstrap Icons - BsEnvelopeDash - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeDash
envelope, mail, email, exclamation, alert, warning, danger, urgent, message, filled, notification, ui, priority - Bootstrap Icons - BsEnvelopeExclamationFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeExclamationFill
envelope, mail, email, exclamation, alert, warning, urgent, outline, message, notification, ui, danger - Bootstrap Icons - BsEnvelopeExclamation - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeExclamation
envelope, mail, email, message, filled, compose, send, inbox, outbox, reply, contact, ui, icon, navigation - Bootstrap Icons - BsEnvelopeFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeFill
envelope, mail, email, heart, love, romantic, greeting, message, valentine, filled, social, gift, card - Bootstrap Icons - BsEnvelopeHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeHeartFill
envelope, mail, email, heart, love, romantic, card, message, outline, valentine, greeting, social - Bootstrap Icons - BsEnvelopeHeart - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeHeart
envelope, mail, email, open, read, message, filled, inbox, opened-mail, communication, ui - Bootstrap Icons - BsEnvelopeOpenFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeOpenFill
envelope, mail, email, open, heart, love, romantic, greeting, message, filled, valentine, read - Bootstrap Icons - BsEnvelopeOpenHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeOpenHeartFill
envelope, mail, email, open, heart, love, romantic, greeting, outline, message, valentine - Bootstrap Icons - BsEnvelopeOpenHeart - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeOpenHeart
envelope, mail, email, open, read, message, outline, inbox, opened-mail, communication, ui - Bootstrap Icons - BsEnvelopeOpen - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeOpen
envelope, mail, email, paper, document, letter, message, filled, compose, attachment, office, write - Bootstrap Icons - BsEnvelopePaperFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopePaperFill
envelope, mail, email, paper, heart, love, letter, greeting, message, filled, romantic, valentine - Bootstrap Icons - BsEnvelopePaperHeartFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopePaperHeartFill
envelope, mail, email, paper, heart, love, letter, greeting, message, outline, romantic - Bootstrap Icons - BsEnvelopePaperHeart - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopePaperHeart
envelope, mail, email, paper, document, letter, outline, compose, write, message, attachment - Bootstrap Icons - BsEnvelopePaper - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopePaper
envelope, mail, email, plus, add, new, compose, create, message, filled, inbox, contact, ui - Bootstrap Icons - BsEnvelopePlusFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopePlusFill
envelope, plus, mail, email, add, new-message, compose, inbox, contact, send, message, draft, email-add, create, ui, button, icon, outline, communication, header, toolbar, sidebar - Bootstrap Icons - BsEnvelopePlus - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopePlus
envelope, slash, block, mute, disable, email, mail, no-mail, restricted, privacy, confidential, block-mail, mute-notifications, filled, icon, warning, ui, status - Bootstrap Icons - BsEnvelopeSlashFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeSlashFill
envelope, slash, no-email, block, mute, disable, reject, restricted, email, mail, privacy, outline, settings, notification-control, silent, ui - Bootstrap Icons - BsEnvelopeSlash - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeSlash
envelope, x, cancel, remove, email, mail, close, delete, error, reject, message-failed, blocked, filled, ui, status, notification - Bootstrap Icons - BsEnvelopeXFill - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeXFill
envelope, x, delete, cancel, email, mail, close, message-failed, remove, outline, notification, warning, ui - Bootstrap Icons - BsEnvelopeX - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelopeX
envelope, email, mail, message, inbox, send, receive, communication, outline, ui, button, toolbar, navigation, contact, notification - Bootstrap Icons - BsEnvelope - SVG | WEBP | PNG | JPG - Icon free download
BsEnvelope
ethernet, network, lan, cable, connection, wired, router, internet, port, connectivity, hardware, outline, tech, iot - Bootstrap Icons - BsEthernet - SVG | WEBP | PNG | JPG - Icon free download
BsEthernet
exclamation, octagon, warning, alert, danger, critical, stop, error, caution, symbol, triangle-alt, attention, ui, indicator, badge, notify, hazard, sign, outline - Bootstrap Icons - BsExclamationOctagon - SVG | WEBP | PNG | JPG - Icon free download
BsExclamationOctagon
exclamation, square, fill, warning, alert, danger, stop, critical, caution, symbol, ui, indicator, badge, notify, filled - Bootstrap Icons - BsExclamationSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsExclamationSquareFill
exclamation, square, warning, alert, danger, outline, critical, notify, indicator, symbol, attention, ui, badge - Bootstrap Icons - BsExclamationSquare - SVG | WEBP | PNG | JPG - Icon free download
BsExclamationSquare
exclamation, triangle, fill, warning, alert, danger, caution, critical, hazard, ui, attention, notify, badge, symbol - Bootstrap Icons - BsExclamationTriangleFill - SVG | WEBP | PNG | JPG - Icon free download
BsExclamationTriangleFill
facebook, fb, meta, social, brand, logo, network, share, community, profile, social-media - Bootstrap Icons - BsFacebook - SVG | WEBP | PNG | JPG - Icon free download
BsFacebook
fan, cooling, air, wind, ventilation, climate, device, appliance, rotate, spin, outline - Bootstrap Icons - BsFan - SVG | WEBP | PNG | JPG - Icon free download
BsFan
file, binary, code, 01, data, developer, programming, filled, system, document, sheet, tech, backend, logic, compiler, ui - Bootstrap Icons - BsFileBinaryFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileBinaryFill
file, binary, 01, code, programming, outline, developer, data, logic, tech, document, sheet, backend, system, engineer - Bootstrap Icons - BsFileBinary - SVG | WEBP | PNG | JPG - Icon free download
BsFileBinary
file, code, filled, developer, programming, script, document, sheet, source, tech, backend, frontend, engineer, syntax, ui - Bootstrap Icons - BsFileCodeFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileCodeFill
file, code, outline, script, developer, programming, source, document, sheet, syntax, tech, tool, engineer, ui - Bootstrap Icons - BsFileCode - SVG | WEBP | PNG | JPG - Icon free download
BsFileCode
file, earmark, post, message, note, content, blog, article, publish, feed, communication, document, write, form, text-block, announcement - Bootstrap Icons - BsFileEarmarkPostFill - SVG | WEBP | PNG | JPG - Icon free download
BsFileEarmarkPostFill
file, post, file-post, message, mail, communication, letter, document, attachment, feed, post-file, announcement, note, office, paper - Bootstrap Icons - BsFilePostFill - SVG | WEBP | PNG | JPG - Icon free download
BsFilePostFill
file, post, file-post, mail, message, communication, document, letter, announcement, note, paper, office, feed - Bootstrap Icons - BsFilePost - SVG | WEBP | PNG | JPG - Icon free download
BsFilePost
fingerprint, biometric, identity, auth, authentication, security, login, scan, access, unlock, verification, privacy, user, pattern, sensor, touch, ios, android - Bootstrap Icons - BsFingerprint - SVG | WEBP | PNG | JPG - Icon free download
BsFingerprint
git, version-control, repository, vcs, commit, branch, merge, developer, coding, software, devtools, cli, github, gitlab, bitbucket, workflow, source-code, brand - Bootstrap Icons - BsGit - SVG | WEBP | PNG | JPG - Icon free download
BsGit
github, octocat, git, repo, repository, source-code, developer, open-source, version-control, commit, branch, merge, devtools, coding, brand, profile, social, login - Bootstrap Icons - BsGithub - SVG | WEBP | PNG | JPG - Icon free download
BsGithub
gitlab, git, repository, vcs, ci-cd, devops, runner, merge-request, pipeline, developer, coding, source-control, brand, open-source - Bootstrap Icons - BsGitlab - SVG | WEBP | PNG | JPG - Icon free download
BsGitlab
google-play, play-store, android, google, store, app-store, download, install, mobile-app, brand, media, music, movies, apps, triangle-icon - Bootstrap Icons - BsGooglePlay - SVG | WEBP | PNG | JPG - Icon free download
BsGooglePlay
google, search, brand, logo, gmail, android, web, login, oauth, signin, profile, internet, browser, technology - Bootstrap Icons - BsGoogle - SVG | WEBP | PNG | JPG - Icon free download
BsGoogle
gpu, graphics-card, video-card, hardware, pci, gaming, render, compute, performance, pc-build, tech, device, workstation - Bootstrap Icons - BsGpuCard - SVG | WEBP | PNG | JPG - Icon free download
BsGpuCard
grid, 3x2, 3x2-grid, gap, filled, layout, interface, ui, matrix, tiles, blocks, dashboard, cards, sections, modules, widgets, apps, home-screen, menu-grid, navigation, button, select, arrange, structure, panel, responsive, web, mobile - Bootstrap Icons - BsGrid3X2GapFill - SVG | WEBP | PNG | JPG - Icon free download
BsGrid3X2GapFill
grid, 3x2, gap, outline, layout, ui, tiles, widgets, modules, sections, dashboard, launcher, app-grid, matrix, responsive, arrange, menu, structure, panel, mobile, web - Bootstrap Icons - BsGrid3X2Gap - SVG | WEBP | PNG | JPG - Icon free download
BsGrid3X2Gap
grip, horizontal, drag, handle, ui, reorder, move, drag-handle, bars, dots, gesture, interaction, slider, resizable, touch, mobile, web, dragging, control - Bootstrap Icons - BsGripHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsGripHorizontal
grip, vertical, drag, handle, reorder, move, drag-handle, dots, bars, ui, gesture, interaction, touch, mobile, web, sort, draggable - Bootstrap Icons - BsGripVertical - SVG | WEBP | PNG | JPG - Icon free download
BsGripVertical
h, letter-h, circle, filled, alphabet, symbol, marker, badge, initial, typography, ui, label, identifier, icon, shape - Bootstrap Icons - BsHCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsHCircleFill
h, letter-h, square, filled, symbol, marker, initial, label, badge, ui, shape, identifier, typography - Bootstrap Icons - BsHSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsHSquareFill
hand, index, pointer, tap, click, interaction, gesture, filled, cursor, touch, select, press, ui, mobile, action, navigation - Bootstrap Icons - BsHandIndexFill - SVG | WEBP | PNG | JPG - Icon free download
BsHandIndexFill
hdd, hard-drive, storage, disk, drive, filled, device, hardware, memory, backup, computer, server, data, capacity - Bootstrap Icons - BsHddFill - SVG | WEBP | PNG | JPG - Icon free download
BsHddFill
hdd, network, network-drive, nas, filled, storage, server, data, infrastructure, cloud, shared-drive, hardware, backup, device - Bootstrap Icons - BsHddNetworkFill - SVG | WEBP | PNG | JPG - Icon free download
BsHddNetworkFill
hdd, rack, server-rack, outline, storage, hardware, data, infrastructure, datacenter, it, device - Bootstrap Icons - BsHddRack - SVG | WEBP | PNG | JPG - Icon free download
BsHddRack
hdd, hard-drive, disk, storage, outline, device, hardware, computer, memory, data, backup, server - Bootstrap Icons - BsHdd - SVG | WEBP | PNG | JPG - Icon free download
BsHdd
headphones, audio, music, sound, listen, earphones, device, outline, media, entertainment, volume, voice, podcast - Bootstrap Icons - BsHeadphones - SVG | WEBP | PNG | JPG - Icon free download
BsHeadphones
headset, vr, virtual-reality, gaming, immersive, 3d, device, outline, technology, entertainment, simulation - Bootstrap Icons - BsHeadsetVr - SVG | WEBP | PNG | JPG - Icon free download
BsHeadsetVr
headset, audio, call, communication, support, microphone, helpdesk, outline, sound, voice, customer-service, gaming, chat - Bootstrap Icons - BsHeadset - SVG | WEBP | PNG | JPG - Icon free download
BsHeadset
house, lock, home-lock, secure-home, security, privacy, property-protection, real-estate, housing, restricted, locked, access-control - Bootstrap Icons - BsHouseLockFill - SVG | WEBP | PNG | JPG - Icon free download
BsHouseLockFill
house, home, lock, house-lock, secured-home, private-home, access-control, locked, property, security, protection, safe, authorization, restricted, ui, button, navbar, sidebar, header, real-estate - Bootstrap Icons - BsHouseLock - SVG | WEBP | PNG | JPG - Icon free download
BsHouseLock
inbox, mail, email, messages, filled, receive, incoming, notifications, communication, folder, ui - Bootstrap Icons - BsInboxFill - SVG | WEBP | PNG | JPG - Icon free download
BsInboxFill
inbox, mail, email, messages, outline, incoming, communication, folder, notifications, ui - Bootstrap Icons - BsInbox - SVG | WEBP | PNG | JPG - Icon free download
BsInbox
inboxes, multiple-inboxes, mail, email, messages, folders, filled, communication, notification, productivity, sorting, ui - Bootstrap Icons - BsInboxesFill - SVG | WEBP | PNG | JPG - Icon free download
BsInboxesFill
inboxes, inbox, mail, email, messages, folders, storage, archive, communication, workspace, dashboard, ui, sidebar, navigation, container, multiple-inbox, incoming, sorting, organization - Bootstrap Icons - BsInboxes - SVG | WEBP | PNG | JPG - Icon free download
BsInboxes
incognito, private, privacy, anonymous, stealth, mask, hidden, security, secret-mode, browsing, identity, profile-hidden, shield, safe-mode - Bootstrap Icons - BsIncognito - SVG | WEBP | PNG | JPG - Icon free download
BsIncognito
instagram, brand, logo, social, social-media, camera, stories, photo-sharing, reels, marketing, influencer, profile, app-icon - Bootstrap Icons - BsInstagram - SVG | WEBP | PNG | JPG - Icon free download
BsInstagram
joystick, game, gaming, controller, console, arcade, play, input, device - Bootstrap Icons - BsJoystick - SVG | WEBP | PNG | JPG - Icon free download
BsJoystick
key, lock, unlock, credential, login, auth, access, filled, security - Bootstrap Icons - BsKeyFill - SVG | WEBP | PNG | JPG - Icon free download
BsKeyFill
key, security, lock, unlock, auth, credential, password, outline - Bootstrap Icons - BsKey - SVG | WEBP | PNG | JPG - Icon free download
BsKey
keyboard, typing, input, device, hardware, keys, filled - Bootstrap Icons - BsKeyboardFill - SVG | WEBP | PNG | JPG - Icon free download
BsKeyboardFill
keyboard, device, input, typing, keys, hardware, outline - Bootstrap Icons - BsKeyboard - SVG | WEBP | PNG | JPG - Icon free download
BsKeyboard
laptop, laptop-fill, notebook, computer, pc, device, workstation, macbook, portable, tech, hardware, remote-work, wfh, profile, dashboard, product-card, shop, icon-button - Bootstrap Icons - BsLaptopFill - SVG | WEBP | PNG | JPG - Icon free download
BsLaptopFill
laptop, notebook, computer, pc, device, portable, tech, hardware, work, remote-work, wfh, profile, dashboard, product, shop, button, ui-icon - Bootstrap Icons - BsLaptop - SVG | WEBP | PNG | JPG - Icon free download
BsLaptop
layers, layers-fill, stack, stacked, group, composition, overlays, map-layers, depth, grouping, multi-layer, editor, layout, panel, icon, badge - Bootstrap Icons - BsLayersFill - SVG | WEBP | PNG | JPG - Icon free download
BsLayersFill
layout, wtf, layout-wtf, unexpected, weird, placeholder, experimental, novelty, debug, developer-joke, icon-placeholder, unknown-layout, quirky, badge, marker - Bootstrap Icons - BsLayoutWtf - SVG | WEBP | PNG | JPG - Icon free download
BsLayoutWtf
line, brand, line-app, messaging, chat, im, communication, social, platform, logo, sms, mobile, japan, korea - Bootstrap Icons - BsLine - SVG | WEBP | PNG | JPG - Icon free download
BsLine
linkedin, brand, logo, social, networking, professional, career, business, resume, profile, job, company, platform - Bootstrap Icons - BsLinkedin - SVG | WEBP | PNG | JPG - Icon free download
BsLinkedin
lock, secure, security, privacy, locked, password, authentication, protection, shield, account, restricted, encryption, safe, guard, ui, web, app - Bootstrap Icons - BsLockFill - SVG | WEBP | PNG | JPG - Icon free download
BsLockFill
lock, security, privacy, password, authentication, restricted, secure, encryption, account, shield, protection, ui, web, app, settings - Bootstrap Icons - BsLock - SVG | WEBP | PNG | JPG - Icon free download
BsLock
mastodon, brand, logo, social, network, federated, microblogging, activitypub, fediverse, communication, platform, profile, avatar, share, post, ui, header, footer, brand-icon - Bootstrap Icons - BsMastodon - SVG | WEBP | PNG | JPG - Icon free download
BsMastodon
medium, brand, logo, writing, blog, article, publisher, content, read, share, platform, social, publication, editorial, story, post, brand-icon - Bootstrap Icons - BsMedium - SVG | WEBP | PNG | JPG - Icon free download
BsMedium
memory, ram, chip, module, hardware, component, device, performance, tech, computer, motherboard, outline, system, upgrade, electronics, iot, server - Bootstrap Icons - BsMemory - SVG | WEBP | PNG | JPG - Icon free download
BsMemory
menu, app-menu, grid, navigation, filled, launcher, apps, dashboard, ui, toolbar, tiles, home-screen, buttons, sidebar, mobile, navigation-drawer - Bootstrap Icons - BsMenuAppFill - SVG | WEBP | PNG | JPG - Icon free download
BsMenuAppFill
messenger, facebook-messenger, chat, brand, logo, message, dm, im, communication, send, social, platform, bubble, conversation, share, brand-icon - Bootstrap Icons - BsMessenger - SVG | WEBP | PNG | JPG - Icon free download
BsMessenger
meta, facebook, brand, logo, company, social, technology, platform, vr, ar, corporate, brand-icon - Bootstrap Icons - BsMeta - SVG | WEBP | PNG | JPG - Icon free download
BsMeta
microsoft, teams, microsoft-teams, brand, logo, chat, collaboration, communication, video-call, meeting, workplace, office, enterprise, productivity, teamwork, group-chat, messaging, remote-work, desktop, webapp, button, navbar, sidebar - Bootstrap Icons - BsMicrosoftTeams - SVG | WEBP | PNG | JPG - Icon free download
BsMicrosoftTeams
microsoft, brand, logo, windows, office, tech, software, corporate, company, ms, brandmark, enterprise, desktop, ecosystem, productivity, technology-company, webapp, navbar, footer - Bootstrap Icons - BsMicrosoft - SVG | WEBP | PNG | JPG - Icon free download
BsMicrosoft
modem, filled, router, internet, network, wifi, device, connectivity, bandwidth, broadband, signal, lan, hardware, settings, tech, iot - Bootstrap Icons - BsModemFill - SVG | WEBP | PNG | JPG - Icon free download
BsModemFill
modem, router, network, wifi, internet, connectivity, hardware, device, lan, broadband, signal, settings, iot, tech - Bootstrap Icons - BsModem - SVG | WEBP | PNG | JPG - Icon free download
BsModem
motherboard, circuit, filled, hardware, chip, electronics, computer, tech, device, board, processor, system, engineer, iot, components - Bootstrap Icons - BsMotherboardFill - SVG | WEBP | PNG | JPG - Icon free download
BsMotherboardFill
motherboard, circuit, outline, hardware, electronics, chip, processor, computer, tech, device, board, components, engineering, iot - Bootstrap Icons - BsMotherboard - SVG | WEBP | PNG | JPG - Icon free download
BsMotherboard
mouse, filled, pointer, input, device, computer, hardware, click, cursor, navigation, desktop, peripheral, interaction, ui - Bootstrap Icons - BsMouseFill - SVG | WEBP | PNG | JPG - Icon free download
BsMouseFill
mouse, outline, pointer, cursor, input, device, computer, hardware, click, peripheral, desktop, navigation - Bootstrap Icons - BsMouse - SVG | WEBP | PNG | JPG - Icon free download
BsMouse
mouse2, filled, mouse, input, device, hardware, computer, pointer, cursor, peripheral, gaming, click, navigation - Bootstrap Icons - BsMouse2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsMouse2Fill
mouse2, outline, mouse, input, device, hardware, computer, pointer, cursor, navigation, peripheral, tech, gaming - Bootstrap Icons - BsMouse2 - SVG | WEBP | PNG | JPG - Icon free download
BsMouse2
mouse3, filled, mouse, input, device, hardware, cursor, pointer, navigation, peripheral, computer, gaming, tech - Bootstrap Icons - BsMouse3Fill - SVG | WEBP | PNG | JPG - Icon free download
BsMouse3Fill
mouse, computer-mouse, pointer, cursor-device, input-device, hardware, usb, bluetooth, click, scroll, device, peripheral, desktop, laptop, mac, windows, linux, workstation, productivity, office, navigation, ui-control - Bootstrap Icons - BsMouse3 - SVG | WEBP | PNG | JPG - Icon free download
BsMouse3
music-player, player, audio-player, media-player, filled, sound, track, song, device, music-ui, controls, playback, playlist - Bootstrap Icons - BsMusicPlayerFill - SVG | WEBP | PNG | JPG - Icon free download
BsMusicPlayerFill
nintendo, switch, gaming, console, brand, nintendo-switch, joycon, portable-console, video-games, entertainment, handheld - Bootstrap Icons - BsNintendoSwitch - SVG | WEBP | PNG | JPG - Icon free download
BsNintendoSwitch
nvidia, brand, gpu, graphics-card, rtx, geforce, hardware, ai, machine-learning, computing, tech - Bootstrap Icons - BsNvidia - SVG | WEBP | PNG | JPG - Icon free download
BsNvidia
nvme, ssd, storage, drive, fast-storage, m2, hardware, device, disk, flash-storage, filled, pc-component - Bootstrap Icons - BsNvmeFill - SVG | WEBP | PNG | JPG - Icon free download
BsNvmeFill
nvme, ssd, storage, drive, solid-state, fast-storage, hardware, component, pc, tech, disk - Bootstrap Icons - BsNvme - SVG | WEBP | PNG | JPG - Icon free download
BsNvme
octagon, shape, eight-sided, polygon, geometry, frame, border, container, stop-shape, warning, highlight, ui-shape, outline, badge, symbol - Bootstrap Icons - BsOctagon - SVG | WEBP | PNG | JPG - Icon free download
BsOctagon
open, collective, opencollective, brand, logo, community, funding, donations, open-source, organization, nonprofit, badge, symbol, platform, crowdfunding - Bootstrap Icons - BsOpencollective - SVG | WEBP | PNG | JPG - Icon free download
BsOpencollective
p, letter-p, circle, p-circle, badge, filled, label, initial, alphabet, marker, symbol, tag, ui-element, button - Bootstrap Icons - BsPCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsPCircleFill
p, letter-p, circle, p-circle, badge, outline, label, initial, alphabet, symbol, tag, marker, ui - Bootstrap Icons - BsPCircle - SVG | WEBP | PNG | JPG - Icon free download
BsPCircle
p, letter-p, square, p-square, badge, filled, label, alphabet, initial, symbol, tag, marker, ui-element - Bootstrap Icons - BsPSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsPSquareFill
p, letter-p, square, p-square, badge, outline, label, alphabet, initial, symbol, marker, tag - Bootstrap Icons - BsPSquare - SVG | WEBP | PNG | JPG - Icon free download
BsPSquare
paperclip, clip, attachment, attach, file-attach, document, email, message, link, binder, office, outline, ui-action - Bootstrap Icons - BsPaperclip - SVG | WEBP | PNG | JPG - Icon free download
BsPaperclip
pass, id-pass, identity, card, access, badge, entry, filled, authentication, user-id, permit, document, credential - Bootstrap Icons - BsPassFill - SVG | WEBP | PNG | JPG - Icon free download
BsPassFill
pass, id-pass, identity, credential, access, badge, outline, document, user-id, permit, authentication - Bootstrap Icons - BsPass - SVG | WEBP | PNG | JPG - Icon free download
BsPass
passport, travel, visa, document, id, international, border, filled, credential, identity, security, air-travel - Bootstrap Icons - BsPassportFill - SVG | WEBP | PNG | JPG - Icon free download
BsPassportFill
patch, check, checkmark, verify, verified, badge, approved, ok, success, confirmation, tick, status, indicator, ui, button, label, mark, symbol - Bootstrap Icons - BsPatchCheckFill - SVG | WEBP | PNG | JPG - Icon free download
BsPatchCheckFill
patch, check, checkmark, verify, verified, badge, approval, ok, success, tick, outline, status, indicator, ui, symbol - Bootstrap Icons - BsPatchCheck - SVG | WEBP | PNG | JPG - Icon free download
BsPatchCheck
paypal, brand, payment, ecommerce, money, transaction, checkout, wallet, gateway, online-payment, logo - Bootstrap Icons - BsPaypal - SVG | WEBP | PNG | JPG - Icon free download
BsPaypal
pc, display, horizontal, monitor, screen, desktop, computer, hardware, ui, workspace, device - Bootstrap Icons - BsPcDisplayHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsPcDisplayHorizontal
pc, display, monitor, desktop, screen, computer, hardware, device, ui, workspace - Bootstrap Icons - BsPcDisplay - SVG | WEBP | PNG | JPG - Icon free download
BsPcDisplay
pc, horizontal, screen, monitor, computer, desktop, device, hardware, ui - Bootstrap Icons - BsPcHorizontal - SVG | WEBP | PNG | JPG - Icon free download
BsPcHorizontal
pc, computer, desktop, workstation, monitor, device, hardware, screen, setup, tech, ui, dashboard, sidebar, toolbar, windows, linux, mac, developer, coding, work - Bootstrap Icons - BsPc - SVG | WEBP | PNG | JPG - Icon free download
BsPc
pci, card, network, pci-card, network-card, adapter, ethernet, lan, hardware, device, chip, module, server, router, nic, bandwidth, connect, system, tech - Bootstrap Icons - BsPciCardNetwork - SVG | WEBP | PNG | JPG - Icon free download
BsPciCardNetwork
pci, card, sound, audio-card, sound-card, hardware, audio, speaker, multimedia, chip, module, device, system, music, media, tech, pc - Bootstrap Icons - BsPciCardSound - SVG | WEBP | PNG | JPG - Icon free download
BsPciCardSound
pci, card, expansion-card, hardware, chip, module, pc, device, system, tech, slot, component, board, electronics - Bootstrap Icons - BsPciCard - SVG | WEBP | PNG | JPG - Icon free download
BsPciCard
peace, symbol, peace-fill, culture, spiritual, harmony, sign, icon, decorative, badge, logo, mark, simple, ui - Bootstrap Icons - BsPeaceFill - SVG | WEBP | PNG | JPG - Icon free download
BsPeaceFill
peace, symbol, outline, harmony, unity, culture, spiritual, sign, decorative, ui, logo, mark - Bootstrap Icons - BsPeace - SVG | WEBP | PNG | JPG - Icon free download
BsPeace
pentagon, shape, geometry, filled, polygon, badge, mark, icon, design, layout, ui, block, container - Bootstrap Icons - BsPentagonFill - SVG | WEBP | PNG | JPG - Icon free download
BsPentagonFill
pentagon, half, half-filled, shape, geometry, polygon, design, rating, indicator, ui, marker, badge - Bootstrap Icons - BsPentagonHalf - SVG | WEBP | PNG | JPG - Icon free download
BsPentagonHalf
pentagon, shape, outline, polygon, geometry, design, marker, badge, ui, container - Bootstrap Icons - BsPentagon - SVG | WEBP | PNG | JPG - Icon free download
BsPentagon
person, badge, filled, id, identity, profile, user, avatar, tag, member, role, permission, security, account - Bootstrap Icons - BsPersonBadgeFill - SVG | WEBP | PNG | JPG - Icon free download
BsPersonBadgeFill
person, badge, id, identity, profile, user, avatar, card, tag, label, member, staff, account, ui, header, sidebar, list, row - Bootstrap Icons - BsPersonBadge - SVG | WEBP | PNG | JPG - Icon free download
BsPersonBadge
person, workspace, user, work, office, desk, employee, staff, team, avatar, profile, business, corporate, tasks, job, workplace, dashboard, ui, menu, sidebar - Bootstrap Icons - BsPersonWorkspace - SVG | WEBP | PNG | JPG - Icon free download
BsPersonWorkspace
phone, mobile, call, device, smartphone, communication, dial, telephone, contact, cell, handset, telecom, ui, menu, sidebar, button - Bootstrap Icons - BsPhoneFill - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneFill
phone, flip, rotate, orientation, mobile, device, smartphone, call, contact, communication, rotate-phone, screen, ui, gesture, interaction - Bootstrap Icons - BsPhoneFlip - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneFlip
phone, landscape, rotate, mobile, smartphone, horizontal, orientation, media-view, full-screen, device, call, ui, layout, responsive - Bootstrap Icons - BsPhoneLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneLandscapeFill
phone, landscape, horizontal, rotate, mobile, device, smartphone, responsive, call, screen, ui, layout, orientation - Bootstrap Icons - BsPhoneLandscape - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneLandscape
phone, vibrate, mobile, alert, notification, silent, device, buzz, smartphone, contact, call, ringer, ui, settings, mode - Bootstrap Icons - BsPhoneVibrateFill - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneVibrateFill
phone, vibrate, mobile, silent, alert, notification, buzz, ringer, device, smartphone, contact, ui, settings, toggle - Bootstrap Icons - BsPhoneVibrate - SVG | WEBP | PNG | JPG - Icon free download
BsPhoneVibrate
phone, mobile, call, device, smartphone, telephone, contact, dial, communication, cellphone, ui, menu, sidebar, icon - Bootstrap Icons - BsPhone - SVG | WEBP | PNG | JPG - Icon free download
BsPhone
pinterest, brand, logo, social, social-media, share, pin, board, content, images, inspiration, marketing, platform, pinterest-brand, social-share - Bootstrap Icons - BsPinterest - SVG | WEBP | PNG | JPG - Icon free download
BsPinterest
playstation, sony, ps, console, gaming, brand, logo, game, controller, platform, entertainment, ps5, ps4 - Bootstrap Icons - BsPlaystation - SVG | WEBP | PNG | JPG - Icon free download
BsPlaystation
plug, power, electric, connector, socket, charge, cable, energy, adapter, electricity, hardware, device, plug-fill - Bootstrap Icons - BsPlugFill - SVG | WEBP | PNG | JPG - Icon free download
BsPlugFill
plug, power, electric, connector, electricity, socket, adapter, cable, charger, device, hardware, utility - Bootstrap Icons - BsPlug - SVG | WEBP | PNG | JPG - Icon free download
BsPlug
power, on, off, switch, toggle, device, system, control - Bootstrap Icons - BsPower - SVG | WEBP | PNG | JPG - Icon free download
BsPower
printer, print, device, hardware, filled, office, copy, document - Bootstrap Icons - BsPrinterFill - SVG | WEBP | PNG | JPG - Icon free download
BsPrinterFill
qr, qr-code, scan, scanner, barcode, camera, payment, ticket, verify, authentication, access, checkout, mobile, square-code, reader, scan-mode, capture, outline, device, utility, shop, coupon - Bootstrap Icons - BsQrCodeScan - SVG | WEBP | PNG | JPG - Icon free download
BsQrCodeScan
qr, qr-code, barcode, code, square-code, matrix, authentication, verify, payment, scan, mobile, ticket, entry, access, checkout, tag, label, outline - Bootstrap Icons - BsQrCode - SVG | WEBP | PNG | JPG - Icon free download
BsQrCode
quora, brand, logo, social, platform, qna, questions, answers, community, discussion, red-logo, app, service - Bootstrap Icons - BsQuora - SVG | WEBP | PNG | JPG - Icon free download
BsQuora
r, letter, alphabet, circle, filled, text, symbol, monogram, badge, marker, initial, character, label - Bootstrap Icons - BsRCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsRCircleFill
radar, scan, signal, detect, tracking, range, circle, waves, sensor, iot, motion, search, locate, find, outline, device - Bootstrap Icons - BsRadar - SVG | WEBP | PNG | JPG - Icon free download
BsRadar
reception, signal, zero-signal, connectivity, network, bars, weak, offline, no-signal, status, indicator, device, wireless - Bootstrap Icons - BsReception0 - SVG | WEBP | PNG | JPG - Icon free download
BsReception0
reception, signal, one-bar, weak, low-signal, connectivity, network, wireless, status, indicator, mobile, device - Bootstrap Icons - BsReception1 - SVG | WEBP | PNG | JPG - Icon free download
BsReception1
reception, signal, two-bars, medium-signal, connectivity, network, wireless, status, indicator, mobile, device - Bootstrap Icons - BsReception2 - SVG | WEBP | PNG | JPG - Icon free download
BsReception2
reception, signal, three-bars, good-signal, connectivity, network, wireless, status, indicator, device, mobile - Bootstrap Icons - BsReception3 - SVG | WEBP | PNG | JPG - Icon free download
BsReception3
reception, signal, four-bars, full-signal, strong, connectivity, network, wireless, status, mobile, indicator - Bootstrap Icons - BsReception4 - SVG | WEBP | PNG | JPG - Icon free download
BsReception4
reddit, brand, logo, social, community, discussion, threads, posts, forum, platform, sharing, avatar, alien, outline - Bootstrap Icons - BsReddit - SVG | WEBP | PNG | JPG - Icon free download
BsReddit
reply, reply-all, respond, email, message, inbox, outbox, send, arrow, communication, chat, comment, forward, back, group-reply, ui, ux, toolbar, button, mail-client, conversation, thread - Bootstrap Icons - BsReplyAllFill - SVG | WEBP | PNG | JPG - Icon free download
BsReplyAllFill
reply, reply-all, respond, email, message, inbox, send, arrow, group, communication, chat, comment, conversation, thread, ui, ux, button, toolbar, mail, customer-support - Bootstrap Icons - BsReplyAll - SVG | WEBP | PNG | JPG - Icon free download
BsReplyAll
reply, respond, back, email, message, inbox, send, arrow, communication, chat, reply-arrow, comment, thread, ui, ux, mail, support - Bootstrap Icons - BsReplyFill - SVG | WEBP | PNG | JPG - Icon free download
BsReplyFill
reply, respond, message, email, arrow, back, inbox, send, communication, chat, comment, thread, ui, ux, mail, toolbar - Bootstrap Icons - BsReply - SVG | WEBP | PNG | JPG - Icon free download
BsReply
robot, bot, ai, automation, machine, android, tech, technology, robotics, assistant, chatbot, automation, iot, device, gadget, toy, avatar, character, automation-ui - Bootstrap Icons - BsRobot - SVG | WEBP | PNG | JPG - Icon free download
BsRobot
router, wifi, network, internet, modem, signal, connectivity, device, hardware, filled, iot, lan, wan, home-network, office-network, tech, settings - Bootstrap Icons - BsRouterFill - SVG | WEBP | PNG | JPG - Icon free download
BsRouterFill
router, wifi, network, internet, device, signal, modem, outline, hardware, iot, lan, wan, connectivity, tech, settings - Bootstrap Icons - BsRouter - SVG | WEBP | PNG | JPG - Icon free download
BsRouter
safe, vault, lockbox, security, protection, storage, bank, finance, money, cash, valuables, secure, strongbox, deposit, safe-fill - Bootstrap Icons - BsSafeFill - SVG | WEBP | PNG | JPG - Icon free download
BsSafeFill
safe, vault, lockbox, security, protection, outline, storage, finance, money, cash, secure, deposit, strongbox - Bootstrap Icons - BsSafe - SVG | WEBP | PNG | JPG - Icon free download
BsSafe
safe, vault, security, protection, safe2, filled, banking, financial-protection, lockbox, strongbox, secure, money, deposit - Bootstrap Icons - BsSafe2Fill - SVG | WEBP | PNG | JPG - Icon free download
BsSafe2Fill
safe, safe2, vault, security, outline, protection, storage, locking, bank, money-box, secure - Bootstrap Icons - BsSafe2 - SVG | WEBP | PNG | JPG - Icon free download
BsSafe2
sd, sd-card, memory, flash, storage, filled, device, media, camera, recording, backup - Bootstrap Icons - BsSdCardFill - SVG | WEBP | PNG | JPG - Icon free download
BsSdCardFill
sd, sd-card, memory, outline, storage, flash, device, camera, media, removable - Bootstrap Icons - BsSdCard - SVG | WEBP | PNG | JPG - Icon free download
BsSdCard
send, arrow-down, send-arrow-down, download, transfer, deliver, message, submit, filled, action, email - Bootstrap Icons - BsSendArrowDownFill - SVG | WEBP | PNG | JPG - Icon free download
BsSendArrowDownFill
send, arrow, arrow-down, down, message, deliver, transfer, upload, download, direction, navigate, submit, outgoing, chat, email, ui, button, action, move-down, indicator, line-icon, bootstrap, outline - Bootstrap Icons - BsSendArrowDown - SVG | WEBP | PNG | JPG - Icon free download
BsSendArrowDown
send, arrow, arrow-up, up, message, deliver, transfer, submit, outgoing, chat, email, upload, navigate, move-up, filled, bootstrap, send-action - Bootstrap Icons - BsSendArrowUpFill - SVG | WEBP | PNG | JPG - Icon free download
BsSendArrowUpFill
send, arrow, arrow-up, message, deliver, transfer, submit, chat, email, upload, outgoing, navigate, move-up, line-icon, bootstrap - Bootstrap Icons - BsSendArrowUp - SVG | WEBP | PNG | JPG - Icon free download
BsSendArrowUp
send, check, send-check, success, delivered, confirmed, message, chat, email, status, success-state, tick, approval, filled, bootstrap - Bootstrap Icons - BsSendCheckFill - SVG | WEBP | PNG | JPG - Icon free download
BsSendCheckFill
send, check, send-check, success, delivered, confirmed, message, chat, email, status, tick, approval, line-icon, bootstrap - Bootstrap Icons - BsSendCheck - SVG | WEBP | PNG | JPG - Icon free download
BsSendCheck
send, dash, send-dash, pending, unknown, message, status, chat, email, undelivered, warning, neutral, filled, bootstrap - Bootstrap Icons - BsSendDashFill - SVG | WEBP | PNG | JPG - Icon free download
BsSendDashFill
send, dash, send-dash, pending, unknown, message, status, chat, email, neutral, undelivered, line-icon, bootstrap - Bootstrap Icons - BsSendDash - SVG | WEBP | PNG | JPG - Icon free download
BsSendDash
send, exclamation, warning, error, alert, message, chat, email, failed, undelivered, attention, filled, bootstrap - Bootstrap Icons - BsSendExclamationFill - SVG | WEBP | PNG | JPG - Icon free download
BsSendExclamationFill
send, exclamation, warning, error, alert, message, chat, email, failed, undelivered, attention, line-icon, bootstrap - Bootstrap Icons - BsSendExclamation - SVG | WEBP | PNG | JPG - Icon free download
BsSendExclamation
send, message, deliver, submit, chat, email, upload, outgoing, transfer, send-icon, filled, bootstrap, button, ui - Bootstrap Icons - BsSendFill - SVG | WEBP | PNG | JPG - Icon free download
BsSendFill
send, plus, add, create, new-message, compose, chat, email, submit, send-plus, filled, bootstrap, action - Bootstrap Icons - BsSendPlusFill - SVG | WEBP | PNG | JPG - Icon free download
BsSendPlusFill
send, plus, add, new, compose, create, chat, email, submit, line-icon, bootstrap, send-plus - Bootstrap Icons - BsSendPlus - SVG | WEBP | PNG | JPG - Icon free download
BsSendPlus
send, slash, blocked, restricted, disabled, cancel, stop, message, chat, email, no-send, filled, bootstrap - Bootstrap Icons - BsSendSlashFill - SVG | WEBP | PNG | JPG - Icon free download
BsSendSlashFill
send, slash, blocked, restricted, disabled, stop, cancel, chat, email, message, not-allowed, line-icon, bootstrap - Bootstrap Icons - BsSendSlash - SVG | WEBP | PNG | JPG - Icon free download
BsSendSlash
send, x, close, cancel, error, failed, alert, message, chat, email, stop, reject, filled, bootstrap - Bootstrap Icons - BsSendXFill - SVG | WEBP | PNG | JPG - Icon free download
BsSendXFill
send, x, cancel, error, failed, alert, chat, email, message, reject, line-icon, bootstrap - Bootstrap Icons - BsSendX - SVG | WEBP | PNG | JPG - Icon free download
BsSendX
send, message, deliver, chat, email, submit, upload, outgoing, transfer, navigate, line-icon, bootstrap - Bootstrap Icons - BsSend - SVG | WEBP | PNG | JPG - Icon free download
BsSend
shield, check, verified, secure, security, protection, auth, authentication, approved, valid, confirmed, ok, status, system, trust, privacy, permissions, ios, android, web - Bootstrap Icons - BsShieldCheck - SVG | WEBP | PNG | JPG - Icon free download
BsShieldCheck
shield, exclamation, warning, alert, caution, danger, security, risk, issue, attention, system-alert, critical, privacy, ios, android, web - Bootstrap Icons - BsShieldExclamation - SVG | WEBP | PNG | JPG - Icon free download
BsShieldExclamation
shield, filled, check, secure, verified, approved, authentication, trust, privacy, success, valid, protection, badge, status - Bootstrap Icons - BsShieldFillCheck - SVG | WEBP | PNG | JPG - Icon free download
BsShieldFillCheck
shield, exclamation, filled, warning, alert, critical, danger, issue, problem, security, risk, protection, system-alert - Bootstrap Icons - BsShieldFillExclamation - SVG | WEBP | PNG | JPG - Icon free download
BsShieldFillExclamation
shield, minus, remove, restrict, limited, blocked, disabled, protection, security, privacy, access, denied, filled, status - Bootstrap Icons - BsShieldFillMinus - SVG | WEBP | PNG | JPG - Icon free download
BsShieldFillMinus
shield, plus, add, grant, permission, access, enable, allow, security, filled, trust, privacy - Bootstrap Icons - BsShieldFillPlus - SVG | WEBP | PNG | JPG - Icon free download
BsShieldFillPlus
shield, x, close, reject, error, deny, blocked, forbidden, access-denied, security, privacy, filled - Bootstrap Icons - BsShieldFillX - SVG | WEBP | PNG | JPG - Icon free download
BsShieldFillX
shield, filled, protection, secure, security, privacy, trust, defense, guard, badge, status - Bootstrap Icons - BsShieldFill - SVG | WEBP | PNG | JPG - Icon free download
BsShieldFill
shield, minus, remove, restricted, blocked, access, denied, limit, security, privacy, outline - Bootstrap Icons - BsShieldMinus - SVG | WEBP | PNG | JPG - Icon free download
BsShieldMinus
shield, plus, add, grant, permission, access, enable, allow, security, privacy, outline - Bootstrap Icons - BsShieldPlus - SVG | WEBP | PNG | JPG - Icon free download
BsShieldPlus
shield, shaded, protection, secure, privacy, security, illustration, layered, defense - Bootstrap Icons - BsShieldShaded - SVG | WEBP | PNG | JPG - Icon free download
BsShieldShaded
shield, slash, blocked, disabled, forbidden, restriction, access-denied, privacy, security, filled, protection - Bootstrap Icons - BsShieldSlashFill - SVG | WEBP | PNG | JPG - Icon free download
BsShieldSlashFill
shield, slash, blocked, disabled, forbidden, restriction, access-denied, privacy, security, outline - Bootstrap Icons - BsShieldSlash - SVG | WEBP | PNG | JPG - Icon free download
BsShieldSlash
shield, x, error, reject, fail, denied, blocked, forbidden, security, privacy, outline - Bootstrap Icons - BsShieldX - SVG | WEBP | PNG | JPG - Icon free download
BsShieldX
shield, security, protection, privacy, guard, defense, outline, trust, safe, status - Bootstrap Icons - BsShield - SVG | WEBP | PNG | JPG - Icon free download
BsShield
sign, do, not, enter, do-not-enter, no-entry, prohibited, forbidden, traffic, road-sign, filled, warning, access-denied, block, security, map, location, route, alert - Bootstrap Icons - BsSignDoNotEnterFill - SVG | WEBP | PNG | JPG - Icon free download
BsSignDoNotEnterFill
sign, do, not, enter, do-not-enter, no-entry, prohibited, forbidden, traffic, road-sign, map, navigation, access-denied, block, security, warning, location, route - Bootstrap Icons - BsSignDoNotEnter - SVG | WEBP | PNG | JPG - Icon free download
BsSignDoNotEnter
signal, wifi, network, bars, strength, connectivity, cellular, status, indicator, connection, reception, mobile, wireless, ui, dashboard, line - Bootstrap Icons - BsSignal - SVG | WEBP | PNG | JPG - Icon free download
BsSignal
sim, sim-card, mobile, cellular, network, chip, card, telecom, device, hardware, connectivity, carrier, filled, slot - Bootstrap Icons - BsSimFill - SVG | WEBP | PNG | JPG - Icon free download
BsSimFill
sim, sim-card, slash, no-sim, disabled, mobile, cellular, network, connectivity, hardware, carrier, warning, filled, blocked - Bootstrap Icons - BsSimSlashFill - SVG | WEBP | PNG | JPG - Icon free download
BsSimSlashFill
sim, sim-card, slash, no-sim, disabled, network, mobile, connectivity, hardware, warning, blocked, line - Bootstrap Icons - BsSimSlash - SVG | WEBP | PNG | JPG - Icon free download
BsSimSlash
sim, sim-card, cellular, mobile, network, chip, telecom, device, hardware, carrier, connectivity, line - Bootstrap Icons - BsSim - SVG | WEBP | PNG | JPG - Icon free download
BsSim
sina, weibo, sina-weibo, china, microblogging, social, platform, brand, logo, network, sharing, community, post, feed - Bootstrap Icons - BsSinaWeibo - SVG | WEBP | PNG | JPG - Icon free download
BsSinaWeibo
skype, brand, microsoft, chat, messaging, video-call, voice-call, communication, meeting, conference, collaboration, team, contact, online, social, platform, logo, brand-icon, communication-tool, softphone - Bootstrap Icons - BsSkype - SVG | WEBP | PNG | JPG - Icon free download
BsSkype
slack, brand, logo, team, workspace, communication, collaboration, chat, messaging, channels, work, office, productivity, online, platform, brand-icon, remote-work, team-chat, business-tool - Bootstrap Icons - BsSlack - SVG | WEBP | PNG | JPG - Icon free download
BsSlack
slash, circle, filled, ban, block, prohibit, forbidden, deny, restrict, no-entry, warning, alert, status, security, disabled, ui, stop, error, prohibition, circle-filled, restriction, access-denied, limit - Bootstrap Icons - BsSlashCircleFill - SVG | WEBP | PNG | JPG - Icon free download
BsSlashCircleFill
slash, circle, slash-circle, prohibit, not-allowed, disabled, forbidden, no, cancel, block, remove, negative, status-icon, badge, button-icon, header, toolbar, sidebar, nav, ui, bootstrap, outline, icon - Bootstrap Icons - BsSlashCircle - SVG | WEBP | PNG | JPG - Icon free download
BsSlashCircle
slash, square, fill, square-fill, slash-square, blocked, forbidden, disabled, cancel, stop, negative, badge, button, ui, filled, bootstrap, icon - Bootstrap Icons - BsSlashSquareFill - SVG | WEBP | PNG | JPG - Icon free download
BsSlashSquareFill
slash, square, slash-square, prohibit, cancel, disabled, forbidden, block, stop, negative, badge, button, ui, toolbar, outline, bootstrap, icon - Bootstrap Icons - BsSlashSquare - SVG | WEBP | PNG | JPG - Icon free download
BsSlashSquare
smartwatch, watch, wearable, wearables, fitness, health, time, timer, device, iot, notifications, wearable-device, product-card, ecommerce, ui, outline, bootstrap, icon - Bootstrap Icons - BsSmartwatch - SVG | WEBP | PNG | JPG - Icon free download
BsSmartwatch
snapchat, snap, snapchat-logo, brand, social, social-network, messaging, stories, camera, share, profile, auth, oauth, social-icon, bootstrap, icon - Bootstrap Icons - BsSnapchat - SVG | WEBP | PNG | JPG - Icon free download
BsSnapchat
snow, flake, winter, weather, cold, seasonal, forecast, snowflake, precipitation, alert, badge, ui, outline, bootstrap, icon - Bootstrap Icons - BsSnow - SVG | WEBP | PNG | JPG - Icon free download
BsSnow
snow, snow-2, flake, winter, cold, weather, snowflake, forecast, seasonal, ui, badge, outline, bootstrap, icon - Bootstrap Icons - BsSnow2 - SVG | WEBP | PNG | JPG - Icon free download
BsSnow2
snow, snow-3, flake, winter, cold, precipitation, weather, forecast, seasonal, ui, badge, outline, bootstrap, icon - Bootstrap Icons - BsSnow3 - SVG | WEBP | PNG | JPG - Icon free download
BsSnow3
sourceforge, brand, logo, open-source, software, development, projects, repo, community, coding, dev, platform - Bootstrap Icons - BsSourceforge - SVG | WEBP | PNG | JPG - Icon free download
BsSourceforge
speaker, sound, audio, volume, loud, device, speaker-filled, music, media, playlist, ui, button, toggle, sound-on, output - Bootstrap Icons - BsSpeakerFill - SVG | WEBP | PNG | JPG - Icon free download
BsSpeakerFill
speaker, sound, audio, volume, device, music, media, sound-icon, ui, mute-toggle, output, playlist - Bootstrap Icons - BsSpeaker - SVG | WEBP | PNG | JPG - Icon free download
BsSpeaker
spotify, brand, logo, music, streaming, playlist, audio, app, entertainment, media, sound - Bootstrap Icons - BsSpotify - SVG | WEBP | PNG | JPG - Icon free download
BsSpotify
stackoverflow, brand, logo, programming, developer, coding, questions, answers, community, dev, platform, tech - Bootstrap Icons - BsStackOverflow - SVG | WEBP | PNG | JPG - Icon free download
BsStackOverflow
stars, rating, favorites, favorite, rate, score, review, highlight, bookmark, mark, ui, badge, icon, star-group, cluster, rating-stars, feedback-stars, header, footer, sidebar, android, ios, material, fluent - Bootstrap Icons - BsStars - SVG | WEBP | PNG | JPG - Icon free download
BsStars
steam, brand, gaming, valve, platform, game-platform, pc-games, launcher, store, game-store, community, profile, badge, logo, brand-logo, games, multiplayer, pc, desktop, client - Bootstrap Icons - BsSteam - SVG | WEBP | PNG | JPG - Icon free download
BsSteam
strava, brand, fitness, tracking, run, cycle, exercise, workout, community, sport, gps, map, health, activity, logo, brand-logo - Bootstrap Icons - BsStrava - SVG | WEBP | PNG | JPG - Icon free download
BsStrava
stripe, brand, payment, checkout, pay, online-payments, gateway, billing, invoice, subscription, finance, merchant, card-payments, logo - Bootstrap Icons - BsStripe - SVG | WEBP | PNG | JPG - Icon free download
BsStripe
substack, brand, blog, newsletter, writer, publication, content, media, post, article, platform, logo, brand-logo, email-newsletter, creator - Bootstrap Icons - BsSubstack - SVG | WEBP | PNG | JPG - Icon free download
BsSubstack
tablet, device, mobile, screen, touch, app, ui, hardware, electronics, filled-device - Bootstrap Icons - BsTabletFill - SVG | WEBP | PNG | JPG - Icon free download
BsTabletFill
tablet, landscape, device, orientation, mobile, screen, touch, ui, hardware, filled-device - Bootstrap Icons - BsTabletLandscapeFill - SVG | WEBP | PNG | JPG - Icon free download
BsTabletLandscapeFill
tablet, landscape, orientation, device, mobile, ui, screen, outline-device - Bootstrap Icons - BsTabletLandscape - SVG | WEBP | PNG | JPG - Icon free download
BsTabletLandscape
tablet, device, screen, mobile, touch, electronics, ui, outline - Bootstrap Icons - BsTablet - SVG | WEBP | PNG | JPG - Icon free download
BsTablet
telegram, brand, logo, messaging, chat, send, communication, social, app, share, platform - Bootstrap Icons - BsTelegram - SVG | WEBP | PNG | JPG - Icon free download
BsTelegram
telephone, phone, call, contact, hotline, support, voice, filled, dial, ui - Bootstrap Icons - BsTelephoneFill - SVG | WEBP | PNG | JPG - Icon free download
BsTelephoneFill
telephone, inbound, call, incoming, phone, receiver, inbound-call, contact, hotline, support, customer-service, call-center, helpdesk, ring, connect, answer, ui, button, toolbar, android, ios, header, footer, sidebar - Bootstrap Icons - BsTelephoneInboundFill - SVG | WEBP | PNG | JPG - Icon free download
BsTelephoneInboundFill
telephone, inbound, incoming, phone, receiver, inbound-call, contact, ring, connect, support, customer-service, call-center, outline, ui, button, navigation, android, ios - Bootstrap Icons - BsTelephoneInbound - SVG | WEBP | PNG | JPG - Icon free download
BsTelephoneInbound
telephone, minus, call, remove-call, phone, receiver, call-action, decline, reduce, disable, mute, block, negative, filled, ui, button, toolbar, header, sidebar - Bootstrap Icons - BsTelephoneMinusFill - SVG | WEBP | PNG | JPG - Icon free download
BsTelephoneMinusFill
telephone, minus, remove-call, phone, receiver, decline, mute, block, disable, outline, call-action, ui, button, toolbar - Bootstrap Icons - BsTelephoneMinus - SVG | WEBP | PNG | JPG - Icon free download
BsTelephoneMinus
telephone, outbound, call, outgoing, phone, receiver, outbound-call, dial, connect, support, customer-service, call-center, filled, ui, toolbar, menu, android, ios - Bootstrap Icons - BsTelephoneOutboundFill - SVG | WEBP | PNG | JPG - Icon free download
BsTelephoneOutboundFill
telephone, outbound, outgoing, call, phone, dial, connect, receiver, call-action, outline, support, toolbar, button, ios, android - Bootstrap Icons - BsTelephoneOutbound - SVG | WEBP | PNG | JPG - Icon free download
BsTelephoneOutbound
telephone, plus, add-call, phone, receiver, new-contact, create-call, add, positive, connect, support, filled, toolbar, button, ui - Bootstrap Icons - BsTelephonePlusFill - SVG | WEBP | PNG | JPG - Icon free download
BsTelephonePlusFill
telephone, plus, add-call, new-call, phone, receiver, add, create, outline, support, toolbar, button, ui - Bootstrap Icons - BsTelephonePlus - SVG | WEBP | PNG | JPG - Icon free download
BsTelephonePlus
telephone, x, cancel-call, end-call, phone, receiver, decline, block, mute, stop, negative, filled, alert, ui, toolbar - Bootstrap Icons - BsTelephoneXFill - SVG | WEBP | PNG | JPG - Icon free download
BsTelephoneXFill
telephone, x, cancel, reject, end-call, phone, receiver, block, decline, outline, alert, ui, button, toolbar - Bootstrap Icons - BsTelephoneX - SVG | WEBP | PNG | JPG - Icon free download
BsTelephoneX
telephone, phone, receiver, call, dial, communication, contact, support, outline, ui, button, header, footer, sidebar - Bootstrap Icons - BsTelephone - SVG | WEBP | PNG | JPG - Icon free download
BsTelephone
tencent, qq, brand, logo, messenger, chat, social, networking, china, profile, avatar, contact, im, communication, app, platform - Bootstrap Icons - BsTencentQq - SVG | WEBP | PNG | JPG - Icon free download
BsTencentQq
thermometer, half, temperature, medium, heat, cool, sensor, climate, weather, health, fever, measurement, device, monitor, environment, temperature-reading, ios, android - Bootstrap Icons - BsThermometerHalf - SVG | WEBP | PNG | JPG - Icon free download
BsThermometerHalf
thermometer, temperature, sensor, measurement, climate, weather, reading, monitor, environment, health, fever, tool, device, ios, android - Bootstrap Icons - BsThermometer - SVG | WEBP | PNG | JPG - Icon free download
BsThermometer
threads, threads-fill, meta, instagram-threads, brand, social, network, platform, logo, chat, feed, community, conversation, profile, social-media, ios, android, web - Bootstrap Icons - BsThreadsFill - SVG | WEBP | PNG | JPG - Icon free download
BsThreadsFill
threads, meta, instagram-threads, brand, platform, social, communication, chat, feed, logo, social-media, community, conversation, profile, ios, android - Bootstrap Icons - BsThreads - SVG | WEBP | PNG | JPG - Icon free download
BsThreads
tiktok, brand, logo, social, social-media, video, short-video, creator, influencer, entertainment, music, app, platform, share, media, marketing - Bootstrap Icons - BsTiktok - SVG | WEBP | PNG | JPG - Icon free download
BsTiktok
trello, brand, logo, board, kanban, task, project, work, management - Bootstrap Icons - BsTrello - SVG | WEBP | PNG | JPG - Icon free download
BsTrello
tv, television, screen, display, monitor, media, video, movie, streaming, entertainment, device, electronics, filled, dashboard-widget - Bootstrap Icons - BsTvFill - SVG | WEBP | PNG | JPG - Icon free download
BsTvFill
tv, television, screen, display, monitor, media, video, movie, streaming, entertainment, device, electronics, outline - Bootstrap Icons - BsTv - SVG | WEBP | PNG | JPG - Icon free download
BsTv
twitch, brand, logo, streaming, live-stream, gaming, esports, social, media, video, content-creator, platform - Bootstrap Icons - BsTwitch - SVG | WEBP | PNG | JPG - Icon free download
BsTwitch
twitter, x, twitter-x, brand, logo, social, media, microblog, tweet, post, share, platform - Bootstrap Icons - BsTwitterX - SVG | WEBP | PNG | JPG - Icon free download
BsTwitterX
twitter, bird, tweet, brand, logo, social, media, microblog, post, share, community - Bootstrap Icons - BsTwitter - SVG | WEBP | PNG | JPG - Icon free download
BsTwitter
ubuntu, linux, os, operating-system, brand, logo, software, open-source, distribution, development, terminal, server - Bootstrap Icons - BsUbuntu - SVG | WEBP | PNG | JPG - Icon free download
BsUbuntu
unity, brand, engine, game-engine, game-dev, 3d, development, graphics, vr, ar, editor, unity-logo - Bootstrap Icons - BsUnity - SVG | WEBP | PNG | JPG - Icon free download
BsUnity
unlock, lock-open, unlock-fill, security, auth, access, permission, privacy, open, key, user-access - Bootstrap Icons - BsUnlockFill - SVG | WEBP | PNG | JPG - Icon free download
BsUnlockFill
unlock, lock-open, security, auth, access, permission, privacy, open, padlock - Bootstrap Icons - BsUnlock - SVG | WEBP | PNG | JPG - Icon free download
BsUnlock
usb, usb-c, type-c, connector, port, hardware, device, cable, power, charging, fill - Bootstrap Icons - BsUsbCFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbCFill
usb, usb-c, type-c, connector, port, hardware, device, charging, data, cable - Bootstrap Icons - BsUsbC - SVG | WEBP | PNG | JPG - Icon free download
BsUsbC
usb, usb-fill, connector, plug, port, hardware, device, tech, data-transfer, charging, cable, peripheral, io, connection, usb-symbol, desktop, laptop, ios, android, interface, sidebar, toolbar, settings, system - Bootstrap Icons - BsUsbFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbFill
usb, micro-usb, usb-micro, connector, mobile-port, charging, data-transfer, device, cable, plug, hardware, io, android, sidebar, toolbar, settings, phone-accessory, tech - Bootstrap Icons - BsUsbMicroFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbMicroFill
usb, micro-usb, usb-micro, connector, charging, data-transfer, mobile, android, cable, hardware, io, outline, tech, device-port, settings, system - Bootstrap Icons - BsUsbMicro - SVG | WEBP | PNG | JPG - Icon free download
BsUsbMicro
usb, mini-usb, usb-mini, connector, legacy-port, hardware, data-transfer, charging, cable, device, tech, io, plug, sidebar, settings - Bootstrap Icons - BsUsbMiniFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbMiniFill
usb, mini-usb, usb-mini, connector, charging, data-transfer, legacy-device, tech, hardware, cable, io, outline, settings, system - Bootstrap Icons - BsUsbMini - SVG | WEBP | PNG | JPG - Icon free download
BsUsbMini
usb, usb-plug, connector, plug, port, cable, charging, data, hardware, device, tech, io, filled, settings, connection, accessory - Bootstrap Icons - BsUsbPlugFill - SVG | WEBP | PNG | JPG - Icon free download
BsUsbPlugFill
usb, usb-plug, connector, plug, port, cable, data-transfer, charging, hardware, device, outline, io, settings, system - Bootstrap Icons - BsUsbPlug - SVG | WEBP | PNG | JPG - Icon free download
BsUsbPlug
usb, usb-symbol, universal-serial-bus, icon, symbol, tech, hardware, connector, data-transfer, charging, standard, logo, outline, settings, system - Bootstrap Icons - BsUsbSymbol - SVG | WEBP | PNG | JPG - Icon free download
BsUsbSymbol
usb, connector, port, data-transfer, charging, tech, hardware, io, outline, device, settings, cable, usb-port - Bootstrap Icons - BsUsb - SVG | WEBP | PNG | JPG - Icon free download
BsUsb
vimeo, brand, logo, video, hosting, streaming, media, social, platform, content, creator, share, publish, brand-icon, video-platform - Bootstrap Icons - BsVimeo - SVG | WEBP | PNG | JPG - Icon free download
BsVimeo
virus, germ, bacteria, pathogen, infection, disease, health, medical, alert, biohazard, security, outline, microbe, science, epidemic - Bootstrap Icons - BsVirus - SVG | WEBP | PNG | JPG - Icon free download
BsVirus
voicemail, voice, message, audio, phone, inbox, call, recording, mailbox, telephony, button, nav, sidebar, notification - Bootstrap Icons - BsVoicemail - SVG | WEBP | PNG | JPG - Icon free download
BsVoicemail
vr, virtual-reality, headset, immersive, 3d, gaming, device, tech, simulation, ar, ui - Bootstrap Icons - BsVr - SVG | WEBP | PNG | JPG - Icon free download
BsVr
watch, clock, time, device, wearable, smartwatch, timer, ui, settings - Bootstrap Icons - BsWatch - SVG | WEBP | PNG | JPG - Icon free download
BsWatch
webcam, camera, video, record, stream, meeting, call, device, conference, ui - Bootstrap Icons - BsWebcamFill - SVG | WEBP | PNG | JPG - Icon free download
BsWebcamFill
webcam, camera, video, device, stream, record, meeting, conference, ui - Bootstrap Icons - BsWebcam - SVG | WEBP | PNG | JPG - Icon free download
BsWebcam
wechat, brand, chat, message, social, communication, app, logo, china, platform - Bootstrap Icons - BsWechat - SVG | WEBP | PNG | JPG - Icon free download
BsWechat
whatsapp, brand, chat, messaging, communication, logo, phone, social, app - Bootstrap Icons - BsWhatsapp - SVG | WEBP | PNG | JPG - Icon free download
BsWhatsapp
wikipedia, wiki, brand, encyclopedia, knowledge, content, reference, education, learning, articles, information - Bootstrap Icons - BsWikipedia - SVG | WEBP | PNG | JPG - Icon free download
BsWikipedia
windows, microsoft, os, brand, desktop, system, logo, software, pc, computer - Bootstrap Icons - BsWindows - SVG | WEBP | PNG | JPG - Icon free download
BsWindows
wordpress, wp, cms, blog, brand, website, publishing, platform, content, editor - Bootstrap Icons - BsWordpress - SVG | WEBP | PNG | JPG - Icon free download
BsWordpress
xbox, brand, microsoft, gaming, console, xbox-logo, entertainment, gamepad, controller, xbox-live - Bootstrap Icons - BsXbox - SVG | WEBP | PNG | JPG - Icon free download
BsXbox
yelp, brand, review, rating, restaurant, business, directory, local, social, platform - Bootstrap Icons - BsYelp - SVG | WEBP | PNG | JPG - Icon free download
BsYelp
youtube, brand, video, media, play, content, channel, streaming, social, creator - Bootstrap Icons - BsYoutube - SVG | WEBP | PNG | JPG - Icon free download
BsYoutube
adidas, brand, logo, sportswear, shoe-brand, apparel, fashion, sport, training, athletic, merchandise, brand-identity, storefront, ecommerce, brand-mark, badge, branding - css.gg Icons - CgAdidas - SVG | WEBP | PNG | JPG - Icon free download
CgAdidas
apple, watch, apple-watch, wearable, smartwatch, ios, device, technology, fitness-tracker, electronics, brand, gadget, mobile - css.gg Icons - CgAppleWatch - SVG | WEBP | PNG | JPG - Icon free download
CgAppleWatch
arrow, long, right, arrow-long-right, direction, navigate, forward, next, rightward, movement, line-arrow, minimal, outline, ui-navigation, header, footer, menu, tab, button, mobile, web - css.gg Icons - CgArrowLongRightR - SVG | WEBP | PNG | JPG - Icon free download
CgArrowLongRightR
arrow, long, right, arrow-long-right, forward, navigate, next, direction, line-arrow, minimal, outline, ui-control, movement, flow, button, web, mobile - css.gg Icons - CgArrowLongRight - SVG | WEBP | PNG | JPG - Icon free download
CgArrowLongRight
arrow, long, up, arrow-long-up, direction, navigate, scroll-up, move-up, ascending, rise, increase, line-arrow, minimal, outline, toolbar, button, mobile, web - css.gg Icons - CgArrowLongUpC - SVG | WEBP | PNG | JPG - Icon free download
CgArrowLongUpC
arrow, long, up, arrow-long-up, navigate, scroll-up, increase, ascending, rise, line-arrow, minimal, outline, ui-navigation, header, footer, menu, web, mobile - css.gg Icons - CgArrowLongUpE - SVG | WEBP | PNG | JPG - Icon free download
CgArrowLongUpE
arrow, long, up, arrow-long-up, ascending, increase, navigate, scroll-up, movement, line-arrow, minimal, outline, ui-element, toolbar, mobile, web - css.gg Icons - CgArrowLongUpL - SVG | WEBP | PNG | JPG - Icon free download
CgArrowLongUpL
arrow, long, up, arrow-long-up, navigate, ascending, rise, increase, scroll-up, movement, line-arrow, minimal, outline, ui, mobile, web - css.gg Icons - CgArrowLongUp - SVG | WEBP | PNG | JPG - Icon free download
CgArrowLongUp
arrow, right, arrow-right, outline-arrow, navigate, next, forward, continue, rightward, minimal, thin-line, ui-button, menu, header, footer, mobile - css.gg Icons - CgArrowRightO - SVG | WEBP | PNG | JPG - Icon free download
CgArrowRightO
arrow, right, arrow-right, navigate, forward, next, direction, movement, line-arrow, minimal, outline, ui-element, tab, menu, mobile, web - css.gg Icons - CgArrowRightR - SVG | WEBP | PNG | JPG - Icon free download
CgArrowRightR
arrow, right, arrow-right, navigate, forward, next, direction, movement, thin-arrow, minimal, outline, ui-button, menu, header, mobile - css.gg Icons - CgArrowRight - SVG | WEBP | PNG | JPG - Icon free download
CgArrowRight
arrow, top, right, top-right, arrow-top-right, navigate, diagonal, forward, next, line-arrow, minimal, outline, ui, header, mobile - css.gg Icons - CgArrowTopRightR - SVG | WEBP | PNG | JPG - Icon free download
CgArrowTopRightR
arrow, up, arrow-up, navigate, scroll-up, increase, ascending, line-arrow, outline, minimal, ui-control, mobile, web - css.gg Icons - CgArrowUpR - SVG | WEBP | PNG | JPG - Icon free download
CgArrowUpR
arrow, up, arrow-up, navigate, ascending, rise, increase, scroll-up, line-arrow, minimal, outline, ui, mobile, web - css.gg Icons - CgArrowUp - SVG | WEBP | PNG | JPG - Icon free download
CgArrowUp
atlassian, brand, jira, confluence, bitbucket, logo, teamwork, devops, collaboration, project-tools, software - css.gg Icons - CgAtlasian - SVG | WEBP | PNG | JPG - Icon free download
CgAtlasian
attachment, clip, paperclip, file, document, email, upload, attach, message, link, note, ui-action - css.gg Icons - CgAttachment - SVG | WEBP | PNG | JPG - Icon free download
CgAttachment
award, awards, trophy, medal, achievement, prize, rank, winner, badge, honor, reward - css.gg Icons - CgAwards - SVG | WEBP | PNG | JPG - Icon free download
CgAwards
battery, empty, low-battery, power, charge, status, warning, device, energy, indicator - css.gg Icons - CgBatteryEmpty - SVG | WEBP | PNG | JPG - Icon free download
CgBatteryEmpty
battery, full, charged, power, energy, device, status, indicator, ready - css.gg Icons - CgBatteryFull - SVG | WEBP | PNG | JPG - Icon free download
CgBatteryFull
battery, power, energy, charge, device, indicator, status, monitor - css.gg Icons - CgBattery - SVG | WEBP | PNG | JPG - Icon free download
CgBattery
bitbucket, brand, logo, atlassian, git, repository, source-code, devops, collaboration, software - css.gg Icons - CgBitbucket - SVG | WEBP | PNG | JPG - Icon free download
CgBitbucket
block, forbidden, stop, restricted, deny, prohibit, security, access, alert, warning - css.gg Icons - CgBlock - SVG | WEBP | PNG | JPG - Icon free download
CgBlock
bmw, brand, car, automotive, vehicle, logo, luxury, transport, motor, company - css.gg Icons - CgBmw - SVG | WEBP | PNG | JPG - Icon free download
CgBmw
bot, robot, ai, automation, assistant, chatbot, virtual-agent, machine, tech, robot-face, bot-head, service-bot, support, automation-tool - css.gg Icons - CgBot - SVG | WEBP | PNG | JPG - Icon free download
CgBot
c++, cplusplus, coding, developer, software, programming, compiler, source-code, language, backend, frontend, system-programming, cpp-logo, brand, learning, ide, code-editor - css.gg Icons - CgCPlusPlus - SVG | WEBP | PNG | JPG - Icon free download
CgCPlusPlus
cast, stream, chromecast, airplay, screen-share, mirror, broadcast, wifi, wireless, device, media, tv - css.gg Icons - CgCast - SVG | WEBP | PNG | JPG - Icon free download
CgCast
chanel, brand, logo, fashion, luxury, designer, clothing, perfume, accessories, style, boutique, ecommerce - css.gg Icons - CgChanel - SVG | WEBP | PNG | JPG - Icon free download
CgChanel
cg, circleci, circle ci, ci, continuous-integration, devops, build, pipeline, automation, integration, github, gitlab, deployment, brand, logo, badge, developer, tooling, platform - css.gg Icons - CgCircleci - SVG | WEBP | PNG | JPG - Icon free download
CgCircleci
cg, clapperboard, clapper, movie, film, video, media, production, shoot, scene, cinema, editor, playback, project, media-control, line, icon-button, toolbar, badge - css.gg Icons - CgClapperBoard - SVG | WEBP | PNG | JPG - Icon free download
CgClapperBoard
cg, codeclimate, code climate, brand, logo, developer, quality, lint, analysis, ci, code-quality, metrics, dashboard, tooling, platform, badge, integration - css.gg Icons - CgCodeClimate - SVG | WEBP | PNG | JPG - Icon free download
CgCodeClimate
comedy, central, comedy-central, brand, logo, tv, media, entertainment, channel, network, brand-icon, show, humor, funny - css.gg Icons - CgComedyCentral - SVG | WEBP | PNG | JPG - Icon free download
CgComedyCentral
comment, chat, message, bubble, speech, discussion, reply, conversation, feedback, communication, social, thread, post-comment, inbox, ui, dialog - css.gg Icons - CgComment - SVG | WEBP | PNG | JPG - Icon free download
CgComment
controller, gamepad, gaming, joystick, play, video-game, console, interactive, buttons, entertainment, device, gamer, input-device - css.gg Icons - CgController - SVG | WEBP | PNG | JPG - Icon free download
CgController
copyright, c-symbol, legal, rights, intellectual-property, ip, ownership, brand, protection, law, license, notice, symbol - css.gg Icons - CgCopyright - SVG | WEBP | PNG | JPG - Icon free download
CgCopyright
crowdfire, brand, logo, social, media, marketing, automation, content, scheduler, app, platform, influencer, engagement, promotion, branding, social-media - css.gg Icons - CgCrowdfire - SVG | WEBP | PNG | JPG - Icon free download
CgCrowdfire
crown, king, queen, royal, premium, vip, ranking, achievement, award, badge, elite, exclusive, status, top, leaderboard, gaming, decor, ui, ux - css.gg Icons - CgCrown - SVG | WEBP | PNG | JPG - Icon free download
CgCrown
data, analytics, info, metrics, statistics, storage, dataset, processing, network, backend, integration, tech, ui, ux, cloud, server - css.gg Icons - CgData - SVG | WEBP | PNG | JPG - Icon free download
CgData
designmodo, brand, logo, design, ui, ux, framework, builder, website, platform, marketing, branding, content, tool, web - css.gg Icons - CgDesignmodo - SVG | WEBP | PNG | JPG - Icon free download
CgDesignmodo
desktop, computer, monitor, screen, pc, display, workstation, device, setup, ui, window, dashboard, workspace, hardware, electronics, home screen, office desk, system ui, toolbar icon, menu icon, panel, layout, productivity, coding setup, developer tools, tech - css.gg Icons - CgDesktop - SVG | WEBP | PNG | JPG - Icon free download
CgDesktop
dialpad, keypad, phone pad, call, dial, number pad, telephone, numpad, contact, communication, telephony, voip, mobile, buttons, grid,  keypad ui, android, ios, call center, input - css.gg Icons - CgDialpad - SVG | WEBP | PNG | JPG - Icon free download
CgDialpad
digitalocean, do, cloud, hosting, server, vps, droplet, brand, devops, infrastructure, deployment, cloud provider, saas platform, hosting service, api, compute, docker, kubernetes, platform, developer tools - css.gg Icons - CgDigitalocean - SVG | WEBP | PNG | JPG - Icon free download
CgDigitalocean
dolby, brand, audio, surround sound, dolby audio, dolby digital, cinema, hd audio, sound quality, speaker, streaming, movie, tv, theater, sound tech, audio enhancement, media playback, entertainment, sound system, hi fi, immersive sound - css.gg Icons - CgDolby - SVG | WEBP | PNG | JPG - Icon free download
CgDolby
dribbble, design, brand, designer community, portfolio, shots, creative network, ui design, ux design, graphics, inspiration, social, profile, logo, community, art, visual design, creative work, gallery, showcase, branding, social media, dribble - css.gg Icons - CgDribbble - SVG | WEBP | PNG | JPG - Icon free download
CgDribbble
drive, storage, disk, hard drive, cloud drive, data, file storage, backup, documents, archive, system, device, external drive, folder, file manager, data management, server drive, sync, cloud storage, upload, download, directory - css.gg Icons - CgDrive - SVG | WEBP | PNG | JPG - Icon free download
CgDrive
eject, media eject, remove, disk eject, device, cd, dvd, usb, safely remove, media control, button, playback, stop, hardware action, storage, system control, exit, popup, tray, drive - css.gg Icons - CgEject - SVG | WEBP | PNG | JPG - Icon free download
CgEject
ereader, ebook, reader, digital book, tablet, kindle, reading, study, learning, content, article, news, document, device, mobile, screen, text, library, education, publication - css.gg Icons - CgEreader - SVG | WEBP | PNG | JPG - Icon free download
CgEreader
ericsson, brand, telecom, network, communication, 5g, mobile network, equipment, infrastructure, connectivity, corporate, technology, wireless, iot, signal, antenna, provider, telecommunications - css.gg Icons - CgEricsson - SVG | WEBP | PNG | JPG - Icon free download
CgEricsson
ethernet, lan, network cable, wired network, connection, port, internet, router, switch, infrastructure, hardware, signal, data, communication, technology, link, connector, cable, network device, wired - css.gg Icons - CgEthernet - SVG | WEBP | PNG | JPG - Icon free download
CgEthernet
eventbrite, brand, events, tickets, event platform, booking, ticketing, promotion, marketing, social event, entertainment, planning, schedule, organizer, event app, business event, conference, meetup, tickets online, brand icon - css.gg Icons - CgEventbrite - SVG | WEBP | PNG | JPG - Icon free download
CgEventbrite
expand, resize, fullscreen, maximize, enlarge, zoom out, layout, window, ui control, open, spread, screen, navigation, button, toolbar, interaction, panel, modal, popout, desktop, mobile, fluid layout - css.gg Icons - CgExpand - SVG | WEBP | PNG | JPG - Icon free download
CgExpand
facebook, fb, social media, brand, logo, network, community, share, post, platform, messaging, profile, timeline, social network, meta, promotion, marketing, follow - css.gg Icons - CgFacebook - SVG | WEBP | PNG | JPG - Icon free download
CgFacebook
framer, framer brand, framer logo, design tool, prototyping, ui design, ux design, animation, interaction design, creative tool, brand, logo, product design, mockup, wireframe, web app, mobile app, design system, frontend, no code, visual editor - css.gg Icons - CgFramer - SVG | WEBP | PNG | JPG - Icon free download
CgFramer
gitter, brand, gitter brand, chat, messaging, developer chat, community, open source, collaboration, communication, team chat, channel, forum, discussion, sidebar, toolbar, logo, social platform, software - css.gg Icons - CgGitter - SVG | WEBP | PNG | JPG - Icon free download
CgGitter
google, tasks, google tasks, brand, checklist, todo, task list, productivity, planner, schedule, organization, task manager, workflow, reminders, planning, office, work, project management, task app, list icon, mobile ui, web app - css.gg Icons - CgGoogleTasks - SVG | WEBP | PNG | JPG - Icon free download
CgGoogleTasks
google, brand, logo, search, engine, internet, browser, gmail, maps, drive, workspace, web, chrome, android, seo, indexing, homepage, header icon, footer icon, sidebar icon - css.gg Icons - CgGoogle - SVG | WEBP | PNG | JPG - Icon free download
CgGoogle
home screen, mobile, screen, layout, homepage, dashboard, ui, navigation, start, welcome, root page, panel, app home, tablet, smartphone - css.gg Icons - CgHomeScreen - SVG | WEBP | PNG | JPG - Icon free download
CgHomeScreen
inbox, mailbox, messages, email, incoming, notification, queue, tasks, workspace, storage, inbox tray, communication, receive, documents, files, mail center, message center, folder inbox, new items, task list - css.gg Icons - CgInbox - SVG | WEBP | PNG | JPG - Icon free download
CgInbox
indie hackers, indiehackers, brand, community, startup founders, makers, entrepreneurs, bootstrappers, saas community, tech group, product builders, founder club, indie dev, creator economy, startup forum, business networking, software makers - css.gg Icons - CgIndieHackers - SVG | WEBP | PNG | JPG - Icon free download
CgIndieHackers
instagram, social, brand, ig, photo, camera, share, social media, stories, reels, followers, profile, feed, influencer, marketing, community, logo, app icon - css.gg Icons - CgInstagram - SVG | WEBP | PNG | JPG - Icon free download
CgInstagram
key, lock, unlock, security, password, credential, login, authentication, access, authorization, key icon, secure, protection, privacy, token, verification, keychain - css.gg Icons - CgKey - SVG | WEBP | PNG | JPG - Icon free download
CgKey
keyboard, typing, input, keys, hardware, device, text entry, computer, pc, laptop, keyboard shortcut, command, controls, accessibility, editor input, ui input - css.gg Icons - CgKeyboard - SVG | WEBP | PNG | JPG - Icon free download
CgKeyboard
laptop, computer, notebook, pc, device, workstation, tech, desktop replacement, coding, developer, designer, ui, dashboard, workspace, remote work, portable device, electronics, hardware, screen, monitor, browser, web app, toolbar, menu - css.gg Icons - CgLaptop - SVG | WEBP | PNG | JPG - Icon free download
CgLaptop
lastpass, brand, password manager, security, auth, login, credentials, vault, key, 2fa, identity management, privacy, password generator, browser extension, cloud security, safe login, account protection, credential storage - css.gg Icons - CgLastpass - SVG | WEBP | PNG | JPG - Icon free download
CgLastpass
live, photo, live photo, motion, motion photo, animated, playback, camera, gallery, profile animation, autoplay, preview, thumbnail, interactive thumbnail, media toggle, media indicator, media preview, social share, mobile ui, web ui, button, badge, icon button, header, card, avatar, animated image, motion preview, autoplay indicator, interactive media, microinteraction - css.gg Icons - CgLivePhoto - SVG | WEBP | PNG | JPG - Icon free download
CgLivePhoto
lock, unlock, lock unlock, padlock, toggle, security, permission, access control, auth, authentication, privacy, enable, disable, toggle security, feature gating, admin control, account, profile, settings, binary state, state change, ux, web ui, mobile ui, button, badge, security indicator, session control, lock state - css.gg Icons - CgLockUnlock - SVG | WEBP | PNG | JPG - Icon free download
CgLockUnlock
lock, padlock, secure, security, authentication, password, privacy, protected, encryption, ssl, secure page, login, auth indicator, account security, authorize, payment security, checkout, form field, input, badge, icon button, web ui, mobile ui, shield, access control, locked, protected content, security status - css.gg Icons - CgLock - SVG | WEBP | PNG | JPG - Icon free download
CgLock
log, off, log off, sign off, disconnect, signout, end session, logout, account, session, terminate, navbar, profile, button, cta, security, shared device, kiosk, multiuser, web ui, mobile ui, admin control, session end, user action, access control, disconnect service - css.gg Icons - CgLogOff - SVG | WEBP | PNG | JPG - Icon free download
CgLogOff
log, out, log out, logout, sign out, signout, exit, end session, account, profile, button, navbar, menu, security, session end, kiosk, multiuser, switch account, mobile ui, web ui, cta, user flow, access control, profile dropdown, terminate session - css.gg Icons - CgLogOut - SVG | WEBP | PNG | JPG - Icon free download
CgLogOut
mail forward, forward, email forward, send, share, redirect, message, inbox, outbox, email action, communication, arrow send, quick send, reply forward, forwarding rule, smtp, email workflow, team sharing, handoff, collaboration tool, material email, android mail, ios mail - css.gg Icons - CgMailForward - SVG | WEBP | PNG | JPG - Icon free download
CgMailForward
mail open, open mail, inbox open, message, email, read mail, view mail, open letter, communication, notifications, inbox view, read status, email preview, content open, document open, material email, ios inbox, android inbox, messaging app, mailbox - css.gg Icons - CgMailOpen - SVG | WEBP | PNG | JPG - Icon free download
CgMailOpen
mail reply, reply, email reply, message reply, respond, answer, inbox, communication, arrow back, email action, reply thread, conversation, support response, team messaging, material reply, ios mail, android mail, customer support, helpdesk, workflow - css.gg Icons - CgMailReply - SVG | WEBP | PNG | JPG - Icon free download
CgMailReply
mail, email, message, letter, envelope, inbox, outbox, communication, contact, send, receive, newsletter, subscription, email tool, smtp, messaging, material email, ios mail, android mail, email icon, notification - css.gg Icons - CgMail - SVG | WEBP | PNG | JPG - Icon free download
CgMail
menu, grid, right, menu grid, grid menu, layout grid, tile view, view toggle, dashboard toggle, toggle layout, grid selector, gallery view, cards, masonry, admin panel, toolbar button, responsive icon, mobile, web, svg, cssgg, react-icons, ux, ui - css.gg Icons - CgMenuGridR - SVG | WEBP | PNG | JPG - Icon free download
CgMenuGridR
menu, left, alt, left menu, menu left alt, sidebar toggle, drawer open, nav open, navigation, panel, layout control, header, toolbar button, mobile, responsive, svg, cssgg, react-icons, ux, ui, sidebar, toggle - css.gg Icons - CgMenuLeftAlt - SVG | WEBP | PNG | JPG - Icon free download
CgMenuLeftAlt
menu, left, left menu, sidebar toggle, drawer, nav, navigation, panel, menu button, header, toolbar, mobile, responsive, svg, cssgg, react-icons, ux, ui, toggle, open, close - css.gg Icons - CgMenuLeft - SVG | WEBP | PNG | JPG - Icon free download
CgMenuLeft
menu, motion, animated, menu motion, animated menu, motion icon, microinteraction, interaction, transition, toggle animation, open close, drawer, toolbar button, mobile, responsive, svg, cssgg, react-icons, ux, ui, prototype, motion design - css.gg Icons - CgMenuMotion - SVG | WEBP | PNG | JPG - Icon free download
CgMenuMotion
menu, oreos, stack, dots, oreo menu, stacked dots, menu stack, compact menu, icon stack, toolbar, header, navbar, context menu, overflow, mobile, responsive, svg, cssgg, react-icons, ux, ui, interaction, click - css.gg Icons - CgMenuOreos - SVG | WEBP | PNG | JPG - Icon free download
CgMenuOreos
menu, right, alt, right menu, menu right alt, sidebar toggle, drawer, nav, panel, layout control, toolbar button, mobile, responsive, svg, cssgg, react-icons, ux, ui, toggle, open, close - css.gg Icons - CgMenuRightAlt - SVG | WEBP | PNG | JPG - Icon free download
CgMenuRightAlt
menu, right, right menu, sidebar toggle, drawer, navigation, panel, menu button, toolbar, header, mobile, responsive, svg, cssgg, react-icons, ux, ui, toggle, open, close - css.gg Icons - CgMenuRight - SVG | WEBP | PNG | JPG - Icon free download
CgMenuRight
menu, round, rounded, round menu, circular, circle, menu button, toolbar, header, navbar, compact, icon button, mobile, responsive, svg, cssgg, react-icons, ux, ui, click, hover - css.gg Icons - CgMenuRound - SVG | WEBP | PNG | JPG - Icon free download
CgMenuRound
menu, cg, hamburger, menu icon, navigation, nav, drawer, sidebar, toggle, menu button, toolbar, header, mobile, responsive, svg, cssgg, react-icons, ux, ui, open, close, interaction, prototype - css.gg Icons - CgMenu - SVG | WEBP | PNG | JPG - Icon free download
CgMenu
mic, microphone, audio, record, voice, sound, speech, talk, podcast, radio, broadcast, call, input, studio, music, sing, chat, communication, device, mute, unmute, toolbar, ui button - css.gg Icons - CgMic - SVG | WEBP | PNG | JPG - Icon free download
CgMic
microbit, micro bit, board, microcontroller, iot, hardware, chips, coding, programming, maker, electronics, prototyping, development board, education, robotics, embedded, device, wearable, stem - css.gg Icons - CgMicrobit - SVG | WEBP | PNG | JPG - Icon free download
CgMicrobit
microsoft, brand, windows, office, teams, azure, tech company, software, enterprise, productivity, cloud services, ms, logo, suite, apps, saas, operating system, developer tools, business tools - css.gg Icons - CgMicrosoft - SVG | WEBP | PNG | JPG - Icon free download
CgMicrosoft
modem, network, router, internet, wifi, connection, broadband, ethernet, signal, lan, wan, device, hardware, iot, gateway, telecom, provider, network setup, bandwidth, data transfer - css.gg Icons - CgModem - SVG | WEBP | PNG | JPG - Icon free download
CgModem
nametag, name tag, id badge, badge, identity, user id, profile tag, visitor pass, employee badge, event badge, contact info, user label, id card, credential, authentication, onboarding, organization, material, ios, android - css.gg Icons - CgNametag - SVG | WEBP | PNG | JPG - Icon free download
CgNametag
notifications, alert, bell, reminder, notify, push, message alert, system alert, status, attention, ping, update, event, inbox, toast, header icon, toolbar icon, ui indicator, mobile alert, web notification, signal, attention mark, badge, hover state, active state, disabled state - css.gg Icons - CgNotifications - SVG | WEBP | PNG | JPG - Icon free download
CgNotifications
npm, node package manager, package manager, nodejs, javascript, js, developer, dev tools, package registry, bundle, module, cli, software, ecosystem, repo, build tools, frontend, backend, dependency, brand, logo, package install, package update, coding workflow - css.gg Icons - CgNpm - SVG | WEBP | PNG | JPG - Icon free download
CgNpm
oculus, meta, vr, virtual reality, headset, gaming, vr device, immersive, 3d, simulation, vr experience, technology brand, logo, hardware, goggles, vr platform, gaming gear, entertainment, brand icon - css.gg Icons - CgOculus - SVG | WEBP | PNG | JPG - Icon free download
CgOculus
open collective, funding, community, open source, donations, contributors, crowdfunding, support, collaboration, sponsorship, organization, brand, logo, teams, community group, financial support, ecosystem - css.gg Icons - CgOpenCollective - SVG | WEBP | PNG | JPG - Icon free download
CgOpenCollective
organisation, organization, hierarchy, structure, team, company, business, groups, workflow, chart, org chart, department, corporate, roles, users, collaboration, management, network, enterprise, diagram - css.gg Icons - CgOrganisation - SVG | WEBP | PNG | JPG - Icon free download
CgOrganisation
overflow, stack overflow, stackoverflow, dev community, developer, programming, coding, qa, questions, answers, forum, knowledge base, brand, logo, developer tools, tech community, software help, documentation - css.gg Icons - CgOverflow - SVG | WEBP | PNG | JPG - Icon free download
CgOverflow
password, login, key, secure, lock, authentication, credentials, pin, access, privacy, security, input field, form, user account, protect, encrypt, unlock, verification, auth flow, sso - css.gg Icons - CgPassword - SVG | WEBP | PNG | JPG - Icon free download
CgPassword
patreon, brand, social, creator platform, membership, subscription, support creators, crowdfunding, logo, badge, icon, influencer, content creator, donation, funding - css.gg Icons - CgPatreon - SVG | WEBP | PNG | JPG - Icon free download
CgPatreon
paypal, brand, payment, checkout, finance, wallet, transaction, online payment, ecommerce, logo, badge, merchant, billing, digital wallet, secure payment - css.gg Icons - CgPaypal - SVG | WEBP | PNG | JPG - Icon free download
CgPaypal
pexels, brand, photo stock, stock images, media library, gallery, photos, image asset, creative commons, photography, pictures, content, visuals, media, download, upload, share, browser, portfolio, designer, editor, creative, resource, image manager - css.gg Icons - CgPexels - SVG | WEBP | PNG | JPG - Icon free download
CgPexels
phone, mobile, smartphone, cell phone, call, dial, contact, communication, device, ios, android, handset, telephony, voice, incoming, outgoing, toolbar, button, ui, connect, ring, messaging, chat - css.gg Icons - CgPhone - SVG | WEBP | PNG | JPG - Icon free download
CgPhone
plug, power plug, connector, electric, socket, charge, charging, energy, power, cable, hardware, device, iot, connection, link, utility, settings, electronics, adapter, plugin, extension - css.gg Icons - CgPlug - SVG | WEBP | PNG | JPG - Icon free download
CgPlug
pokemon, brand, gaming, game, pokeball, anime, nintendo, creatures, monster, collectibles, fandom, entertainment, franchise, logo, badge, iconic, pop culture - css.gg Icons - CgPokemon - SVG | WEBP | PNG | JPG - Icon free download
CgPokemon
printer, print, device, hardware, office, document, paper, copy, scan, output, file, stationery, settings, utility, peripheral, workstation - css.gg Icons - CgPrinter - SVG | WEBP | PNG | JPG - Icon free download
CgPrinter
producthunt, product hunt, brand, logo, startup, launch, community, tech, product discovery, platform, marketing, badge, social, startup ecosystem, promotion - css.gg Icons - CgProductHunt - SVG | WEBP | PNG | JPG - Icon free download
CgProductHunt
remote, controller, remote control, iot, device, media, tv remote, smart home, automation, bluetooth, signal, infrared, control panel, electronics, settings, input device, android, ios, ui control - css.gg Icons - CgRemote - SVG | WEBP | PNG | JPG - Icon free download
CgRemote
wide screen, screen wide, monitor, display, widescreen, ultrawide, desktop, resolution, aspect ratio, landscape, tv, presentation, workspace, layout, frame, panel, ui frame, window, hardware, device - css.gg Icons - CgScreenWide - SVG | WEBP | PNG | JPG - Icon free download
CgScreenWide
screen, monitor, display, desktop, device, frame, window, layout, resolution, panel, tv, presentation, workstation, ui, hardware, system panel, viewport, app window - css.gg Icons - CgScreen - SVG | WEBP | PNG | JPG - Icon free download
CgScreen
shape, circle, round, ellipse, dot, geometry, graphic design, vector, ui shape, mask, sticker, badge, placeholder, avatar frame, button shape, minimal icon, outline circle, perfect round - css.gg Icons - CgShapeCircle - SVG | WEBP | PNG | JPG - Icon free download
CgShapeCircle
shield, protect, protection, security, privacy, guard, defense, secure, safety, auth, authentication, access control, firewall, anti malware, trust, secure icon, badge, certificate, ios, android, web - css.gg Icons - CgShield - SVG | WEBP | PNG | JPG - Icon free download
CgShield
shutterstock, brand, stock images, stock photos, media library, creative assets, content marketplace, photo service, image bank, design resources, licensed images, photography stock, branding icon, logo, asset repository, digital media - css.gg Icons - CgShutterstock - SVG | WEBP | PNG | JPG - Icon free download
CgShutterstock
slack, brand, chat, messaging, team, workspace, collaboration, communication, work chat, channels, dm, company communication, remote work, notifications, productivity app, teamwork, group chat, workflows - css.gg Icons - CgSlack - SVG | WEBP | PNG | JPG - Icon free download
CgSlack
smartphone chip, chip, processor, mobile chip, cpu, hardware, device, phone, smartphone, silicon, core, performance, speed, mobile hardware, tech, electronics, embedded, board, circuit, component, engineering, optimization, ui icon, toolbar - css.gg Icons - CgSmartphoneChip - SVG | WEBP | PNG | JPG - Icon free download
CgSmartphoneChip
smartphone ram, ram, memory, device memory, mobile ram, hardware, smartphone, phone, performance, speed, multitasking, mobile hardware, specs, memory module, optimization, system, ui icon, toolbar - css.gg Icons - CgSmartphoneRam - SVG | WEBP | PNG | JPG - Icon free download
CgSmartphoneRam
smartphone shake, shake, gesture, motion, vibration, phone shake, interaction, mobile, smartphone, alert, notification, movement, haptic, feedback, device interaction, ui gesture, event trigger, toolbar - css.gg Icons - CgSmartphoneShake - SVG | WEBP | PNG | JPG - Icon free download
CgSmartphoneShake
smartphone, phone, mobile, device, cellphone, touchscreen, handheld, communication, call, sms, app, ios, android, ui icon, navigation, toolbar, mobile device, electronics - css.gg Icons - CgSmartphone - SVG | WEBP | PNG | JPG - Icon free download
CgSmartphone
smile, happy, emoji, face, positive, joy, expression, friendly, mood, reaction, comment, chat, messaging, profile, avatar, status icon, feedback, ui icon, lightweight icon, minimal - css.gg Icons - CgSmile - SVG | WEBP | PNG | JPG - Icon free download
CgSmile
stark, logo inspired, symbol, mark, emblem, minimal icon, decorative, branding element, badge, abstract shape, sharp edges, graphic symbol, css gg - css.gg Icons - CgStark - SVG | WEBP | PNG | JPG - Icon free download
CgStark
tag, label, price tag, discount tag, metadata, category tag, identifier, bookmark tag, labeling, sale, store, listing, filter tag, ui element, chip, badge, commerce, retail - css.gg Icons - CgTag - SVG | WEBP | PNG | JPG - Icon free download
CgTag
terminal, console, command line, cli, shell, code, developer, programming, bash, zsh, server, debugging, admin, root access, system tools, devops, scripting, automation, coding environment, tech - css.gg Icons - CgTerminal - SVG | WEBP | PNG | JPG - Icon free download
CgTerminal
trello, brand, kanban, boards, tasks, project management, collaboration, productivity, planning, workflow, task board, scrum, agile, jira alternative, team work, organize, lists, cards, project tracking, team tools, planning board - css.gg Icons - CgTrello - SVG | WEBP | PNG | JPG - Icon free download
CgTrello
trophy, award, achievement, win, success, champion, badge, prize, victory, goal, milestone, contest, ranking, leaderboard, reward, sport, competition, cup, celebration, honor, completion, gamification - css.gg Icons - CgTrophy - SVG | WEBP | PNG | JPG - Icon free download
CgTrophy
tv, television, screen, display, monitor, video, stream, broadcast, media, entertainment, show, movie, series, watch, smart tv, home theater, device, program, display unit, electronics, output device - css.gg Icons - CgTv - SVG | WEBP | PNG | JPG - Icon free download
CgTv
twilio, brand, communication, sms, voice, api, voip, messaging, call, otp, verification, platform, cloud comms, developer tools, integration, auth, customer service, notifications, contact center, twilio icon - css.gg Icons - CgTwilio - SVG | WEBP | PNG | JPG - Icon free download
CgTwilio
twitter, brand, social, tweet, bird, microblog, social network, post, share, communication, x platform, follow, engagement, viral, social media, profile, feed, timeline, hashtags, community, marketing, promotion - css.gg Icons - CgTwitter - SVG | WEBP | PNG | JPG - Icon free download
CgTwitter
unblock, allow, permission, unlock, access, open, restore, contact, communication, enable, remove block, restriction, approve, grant, security, trust, user control, privacy, collaboration, interaction, status change - css.gg Icons - CgUnblock - SVG | WEBP | PNG | JPG - Icon free download
CgUnblock
unsplash, brand, photo, image library, stock photos, gallery, media source, photography, creative assets, image provider, content creation, designer resources, api, photo download, visual content - css.gg Icons - CgUnsplash - SVG | WEBP | PNG | JPG - Icon free download
CgUnsplash
vercel, brand, deployment, hosting, serverless, nextjs, frontend, web app, build, deploy, cloud platform, developer tools, static hosting, jamstack, modern web - css.gg Icons - CgVercel - SVG | WEBP | PNG | JPG - Icon free download
CgVercel
voicemail, voicemail o, voice message, phone, inbox, missed call, voice mail, communication, audio message, call logs, telecom, phone system, recorded message, mailbox, callback, notification - css.gg Icons - CgVoicemailO - SVG | WEBP | PNG | JPG - Icon free download
CgVoicemailO
voicemail, voicemail r, voice message, recorded message, phone, telecom, call inbox, missed call, audio message, communication, voice mailbox, callback, notification, call management, voip - css.gg Icons - CgVoicemailR - SVG | WEBP | PNG | JPG - Icon free download
CgVoicemailR
voicemail, voice mail, message, audio message, phone, call, inbox, recording, communications, telephone, contact, support, customer service, callback, voice note, audio inbox, mobile ui, sidebar, toolbar, button, inbound call - css.gg Icons - CgVoicemail - SVG | WEBP | PNG | JPG - Icon free download
CgVoicemail
windows, microsoft, os, operating system, pc, desktop, brand, logo, win, software, system ui, platform, computer, tech brand, startup screen - css.gg Icons - CgWindows - SVG | WEBP | PNG | JPG - Icon free download
CgWindows
work, job, briefcase, office, career, employment, tasks, business, workplace, professional, portfolio, employee, management, job listing, task management, corporate, admin - css.gg Icons - CgWorkAlt - SVG | WEBP | PNG | JPG - Icon free download
CgWorkAlt
youtube, yt, video, streaming, brand, logo, play button, channel, creator, subscribe, social media, content, vlog, livestream, influencer, marketing, promotion - css.gg Icons - CgYoutube - SVG | WEBP | PNG | JPG - Icon free download
CgYoutube
apple, brand, logo, apple logo, mac, iphone, ipad, ios, macos, technology, apple inc, tech brand, computer, smartphone, device, hardware, premium brand, consumer tech, branding, store, app store, ecosystem, apple product, apple icon - Circum Icons - CiApple - SVG | WEBP | PNG | JPG - Icon free download
CiApple
at symbol, at, email, mention, address, contact, handle, username, notification, tagging, reply, message, chat, comment, social media, profile, account, digital id, ui icon, header, footer, form field, input, typography symbol, symbol, web - Circum Icons - CiAt - SVG | WEBP | PNG | JPG - Icon free download
CiAt
at symbol, at, email, mention, address, contact, handle, username, notification, tagging, reply, message, chat, comment, social media, profile, account, digital id, ui icon, header, footer, form field, input, typography symbol, symbol, web - Circum Icons - CiAt - SVG | WEBP | PNG | JPG - Icon free download
CiAt
chat, message, conversation, comment, bubble, speech bubble, reply, dm, customer support, talk, discussion, communication, messaging app, social chat, chatbox, chat ui, inbox, contact, text message, commenting, thread - Circum Icons - CiChat1 - SVG | WEBP | PNG | JPG - Icon free download
CiChat1
desktop, computer, monitor, screen, display, pc, workstation, device, hardware, ui, window, os, browser, coding, design, dashboard, frontend, backend, work, office, productivity, tech - Circum Icons - CiDesktop - SVG | WEBP | PNG | JPG - Icon free download
CiDesktop
facebook, brand, social media, meta, fb, share, like, social platform, network, community, communication, messaging, profile, page, social login, oauth, marketing, ios, android - Circum Icons - CiFacebook - SVG | WEBP | PNG | JPG - Icon free download
CiFacebook
hard drive, storage, disk, hdd, ssd, device, hardware, backup, memory, server, database, data, archive, external drive, internal drive, system storage, tech, computer, pc, drive icon, utility, file management, storage device, capacity, cloud sync, data center, infrastructure, ios, android - Circum Icons - CiHardDrive - SVG | WEBP | PNG | JPG - Icon free download
CiHardDrive
headphones, audio, music, listen, sound, media, earphones, headset, song, playlist, podcast, volume, streaming, entertainment, device, wearable, gaming, bass, audio gear, speaker, sound quality, music app, audio control, relax, studio, dj, ios, android, material - Circum Icons - CiHeadphones - SVG | WEBP | PNG | JPG - Icon free download
CiHeadphones
instagram, brand, social media, photo, camera, share, ig, stories, reels, profile, network, community, influencer, media post, social icon, logo, social button, mobile app, messaging, photography app, story sharing - Circum Icons - CiInstagram - SVG | WEBP | PNG | JPG - Icon free download
CiInstagram
laptop, notebook, computer, pc, device, workstation, programming, coding, remote work, study, office, portable computer, screen, display, tech, hardware, electronics, workflow, online meeting, digital work - Circum Icons - CiLaptop - SVG | WEBP | PNG | JPG - Icon free download
CiLaptop
light, lamp, bulb, illumination, brightness, lighting, toggle, on off, energy, electric, power, home automation, smart light, brightness control, ambient, ui control, household, device, settings, environment - Circum Icons - CiLight - SVG | WEBP | PNG | JPG - Icon free download
CiLight
linkedin, brand, social media, professional network, career, resume, profile, business, company page, connect, job search, logo, social button, network, messaging, corporate, hr, recruiting, team, branding - Circum Icons - CiLinkedin - SVG | WEBP | PNG | JPG - Icon free download
CiLinkedin
lock, secure, security, privacy, password, authentication, auth, login, protection, restricted, vault, safe, encryption, secure area, credentials, ui lock, toolbar, sidebar, ios, android, web app, padlock - Circum Icons - CiLock - SVG | WEBP | PNG | JPG - Icon free download
CiLock
mail, email, message, inbox, letter, envelope, send, receive, communication, contact, newsletter, support, helpdesk, form, ui button, toolbar, header, footer, mobile ui, ios, android, email icon - Circum Icons - CiMail - SVG | WEBP | PNG | JPG - Icon free download
CiMail
medal, award, trophy, badge, achievement, prize, ranking, winner, reward, success, honor, competition, game reward, profile badge, milestone, goal completion, certificate, recognition - Circum Icons - CiMedal - SVG | WEBP | PNG | JPG - Icon free download
CiMedal
medal, award, trophy, badge, achievement, prize, ranking, winner, reward, success, honor, competition, game reward, profile badge, milestone, goal completion, certificate, recognition - Circum Icons - CiMedal - SVG | WEBP | PNG | JPG - Icon free download
CiMedal
monitor, screen, display, desktop, computer, pc, workstation, tech, device, ui layout, web design, coding, editor, dashboard, analytics screen, presentation, workspace, hardware, resolution, flat screen, lcd, interface, window, browser, view - Circum Icons - CiMonitor - SVG | WEBP | PNG | JPG - Icon free download
CiMonitor
paper plane, send, message, share, send message, direct message, dm, communication, email, submit, send icon, share file, forward, outgoing, paperplane, delivery, fly, post, transmit, social messaging - Circum Icons - CiPaperplane - SVG | WEBP | PNG | JPG - Icon free download
CiPaperplane
passport, id, identity, document, travel, international, visa, border control, legal document, security, identification, travel doc, globe stamp, tourism, flight, airport, immigration, customs, paperwork, official - Circum Icons - CiPassport1 - SVG | WEBP | PNG | JPG - Icon free download
CiPassport1
monitor, screen, display, desktop, computer, pc, workstation, tech, device, ui layout, web design, coding, editor, dashboard, analytics screen, presentation, workspace, hardware, resolution, flat screen, lcd, interface, window, browser, view - Circum Icons - CiMonitor - SVG | WEBP | PNG | JPG - Icon free download
CiMonitor
paper plane, send, message, share, send message, direct message, dm, communication, email, submit, send icon, share file, forward, outgoing, paperplane, delivery, fly, post, transmit, social messaging - Circum Icons - CiPaperplane - SVG | WEBP | PNG | JPG - Icon free download
CiPaperplane
passport, id, identity, document, travel, international, visa, border control, legal document, security, identification, travel doc, globe stamp, tourism, flight, airport, immigration, customs, paperwork, official - Circum Icons - CiPassport1 - SVG | WEBP | PNG | JPG - Icon free download
CiPassport1
satellite, space, gps, signal, transmission, broadcast, communication, orbit, antenna, navigation, tracking, telecom, remote sensing, geo, satcom, network coverage, global mapping, science tech, space device - Circum Icons - CiSatellite1 - SVG | WEBP | PNG | JPG - Icon free download
CiSatellite1
share, export, send, social share, forward, share icon, distribute, broadcast, publish, external link, share button, ui action, android, ios, material, fluent, content sharing, collaboration, social media, messaging, toolbar action, header icon, link sharing, quick actions, clickable - Circum Icons - CiShare1 - SVG | WEBP | PNG | JPG - Icon free download
CiShare1
share, send, forward, external share, social share, export, broadcast, publish, outbound, link sharing, content share, ui action, toolbar, header icon, quick actions, material, ios, android, fluent, messaging, marketing, distribution, clickable - Circum Icons - CiShare2 - SVG | WEBP | PNG | JPG - Icon free download
CiShare2
tag, shopping tag, price tag, label, pricing, sale, discount, promo, offer, retail tag, ecommerce, store, product label, catalog, brand, barcode, coupon, marketing, merchandise, storefront, product tag, price marker, item label, ios, android, outline tag - Circum Icons - CiShoppingTag - SVG | WEBP | PNG | JPG - Icon free download
CiShoppingTag
trophy, award, achievement, win, victory, reward, badge, medal, success, leaderboard, ranking, goal, challenge, competition, contest, gaming, score, milestone, accomplishment, recognition, ui badge - Circum Icons - CiTrophy - SVG | WEBP | PNG | JPG - Icon free download
CiTrophy
twitter, brand, social media, tweet, x, microblog, share, communication, community, network, promotion, marketing, social platform, social network, social icon, post, follow, profile, hashtag, timeline - Circum Icons - CiTwitter - SVG | WEBP | PNG | JPG - Icon free download
CiTwitter
unlock, open lock, access, permission, security, auth, authentication, authorization, privacy, keyless, unlocking, padlock, login, settings, secure area, access granted, material, ios, android - Circum Icons - CiUnlock - SVG | WEBP | PNG | JPG - Icon free download
CiUnlock
unread, message unread, new mail, notification, badge, inbox, email, chat, status, alert, new item, pending, highlight, communication, update, bubble, indicator, toolbar, header - Circum Icons - CiUnread - SVG | WEBP | PNG | JPG - Icon free download
CiUnread
usb, connector, port, plug, peripheral, device, storage, flash drive, cable, connection, interface port, hardware, electronics, wired, tech, data transfer, adapter, symbol, io - Circum Icons - CiUsb - SVG | WEBP | PNG | JPG - Icon free download
CiUsb
vault, safe, security, lockbox, bank, secure storage, protection, privacy, strongbox, finance, assets, data security, deposit, locker, banking, confidential, secure area, authorization - Circum Icons - CiVault - SVG | WEBP | PNG | JPG - Icon free download
CiVault
video off, camera off, disable video, mute video, call, meeting, conference, webcam, streaming, communication, media, status, indicator, toggle, privacy, recording off, toolbar action, ui control - Circum Icons - CiVideoOff - SVG | WEBP | PNG | JPG - Icon free download
CiVideoOff
video on, camera on, enable video, webcam, streaming, live, recording, conference, call, communication, media, toggle, status, video feed, ui control, toolbar, meeting, capture - Circum Icons - CiVideoOn - SVG | WEBP | PNG | JPG - Icon free download
CiVideoOn
voicemail, voice message, inbox, audio message, missed call, phone, telecom, message center, recording, call log, communication, support line, customer support, mobile ui, audio inbox, call notification, voice inbox - Circum Icons - CiVoicemail - SVG | WEBP | PNG | JPG - Icon free download
CiVoicemail
warning, alert, caution, exclamation, triangle, hazard, attention, error, notify, notification, badge, banner, toast, modal, status indicator, form validation, security, system alert, monitoring, admin, support, help, ux, header, sidebar, footer, icon, symbol, attention required, danger - Circum Icons - CiWarning - SVG | WEBP | PNG | JPG - Icon free download
CiWarning
wifi, wifi off, offline, disconnected, no signal, network, wireless, airplane mode, hotspot, router, network error, connectivity issue, status indicator, disabled, troubleshoot, mobile, device, admin, fallback, offline mode, icon, symbol, header, notification, toast, banner, settings - Circum Icons - CiWifiOff - SVG | WEBP | PNG | JPG - Icon free download
CiWifiOff
wifi, wifi on, connected, online, signal, wireless, hotspot, network, strong signal, router, internet, status indicator, connection, pairing, available network, device, mobile, admin, header, footer, toolbar, icon, symbol, badge, ux, connect, wifi-available, network-success, hotspot-available - Circum Icons - CiWifiOn - SVG | WEBP | PNG | JPG - Icon free download
CiWifiOn
youtube, brand, video, youtube logo, youtube icon, subscribe, channel, play, streaming, vlogger, content creator, youtuber, social media, embed, share, header, footer, link, cta, marketing, promotion, media, platform, playlist, live stream, video gallery, watch - Circum Icons - CiYoutube - SVG | WEBP | PNG | JPG - Icon free download
CiYoutube
android, brand, google, mobile, os, sdk, android logo, kotlin, java, android studio, adb, app, platform, developer, mobile development, play store, apk, device, support, tech stack, tooling, integration, documentation, badge, logo - Devicons - DiAndroid - SVG | WEBP | PNG | JPG - Icon free download
DiAndroid
angular, brand, framework, typescript, frontend, web, spa, ng, angular logo, components, cli, rxjs, module, single page, developer, tech stack, tutorial, project badge, ui framework, google, app, build, cdn, logo - Devicons - DiAngularSimple - SVG | WEBP | PNG | JPG - Icon free download
DiAngularSimple
apple, mac, ios, macos, iphone, ipad, imac, brand logo, tech brand, fruit logo, apple ecosystem, app store, apple developer, design, hardware, smartphone, desktop, laptop, apple icon - Devicons - DiApple - SVG | WEBP | PNG | JPG - Icon free download
DiApple
blackberry, mobile phone, smartphone, enterprise device, secure phone, messaging, bbos, hardware brand, qwerty phone, mobility, corporate communication, brand icon, mobile security, handset, legacy mobile, wireless, telecom, business phone, handheld device - Devicons - DiBlackberry - SVG | WEBP | PNG | JPG - Icon free download
DiBlackberry
clojure, clojure logo, lisp, functional programming, fp, jvm, language, developer, programming, software, tech, backend stack, scripting, automation, engineering, tools, runtime, ecosystem - Devicons - DiClojure - SVG | WEBP | PNG | JPG - Icon free download
DiClojure
coda, panic coda, text editor, ide, developer tool, mac editor, programming, coding, web development, workspace, syntax, project editor, software tools, tech, developer environment, frontend, backend - Devicons - DiCoda - SVG | WEBP | PNG | JPG - Icon free download
DiCoda
code badge, badge, label, tag, tech badge, code logo, developer tag, coding, programming, symbol, icon badge, ui badge, project badge, repository tag, devtools, workflow, developer identity - Devicons - DiCodeBadge - SVG | WEBP | PNG | JPG - Icon free download
DiCodeBadge
code, coding, programming, editor, ide, developer, tech, syntax, tools, development, software, workflow, env, coding tool, web development, script, frameworks, engineering - Devicons - DiCode - SVG | WEBP | PNG | JPG - Icon free download
DiCode
creative commons, cc badge, license, permissions, copyright, open content, media rights, publishing, attribution, legal, usage rights, documentation, badge, symbol, share, reuse, content distribution, open source, compliance, policy - Devicons - DiCreativecommonsBadge - SVG | WEBP | PNG | JPG - Icon free download
DiCreativecommonsBadge
debian, linux, os, operating system, debian logo, debian brand, linux distro, gnu linux, server, infrastructure, sysadmin, terminal, bash, shell, devops, cloud, deployment, open source, package manager, apt, web servers, backend, hosting, vm, virtualization, developer tools, it ops, brand - Devicons - DiDebian - SVG | WEBP | PNG | JPG - Icon free download
DiDebian
digitalocean, do, cloud hosting, vps, droplets, kubernetes, containers, devops, server, infrastructure, cloud compute, cloud provider, scaling, deployment, hosting platform, developer platform, load balancer, spaces storage, cdn, api, dashboard, startup hosting, brand - Devicons - DiDigitalOcean - SVG | WEBP | PNG | JPG - Icon free download
DiDigitalOcean
django, python, django framework, backend, web framework, mtv, orm, api, server side, routing, templates, models, views, admin panel, full stack, development, backend tools, open source, authentication, rest, drf, scalable apps, brand - Devicons - DiDjango - SVG | WEBP | PNG | JPG - Icon free download
DiDjango
dlang, d language, programming language, system programming, compiled language, performance, backend, native apps, dlang logo, developer tools, compiler, memory management, cross platform, open source, runtime, modules, scripting, brand - Devicons - DiDlang - SVG | WEBP | PNG | JPG - Icon free download
DiDlang
docker, containers, docker logo, containerization, devops, kubernetes, images, registry, docker hub, cloud, infrastructure, deployment, scaling, orchestration, microservices, compose, swarm, virtualization, serverless, cicd, automation, developer tools, brand - Devicons - DiDocker - SVG | WEBP | PNG | JPG - Icon free download
DiDocker
doctrine, orm, php, database, doctrine orm, entity mapping, models, entities, queries, persistence, data layer, backend, framework, symfony, php ecosystem, sql, schema, migration, developer tools, open source, brand - Devicons - DiDoctrine - SVG | WEBP | PNG | JPG - Icon free download
DiDoctrine
dojo, dojo toolkit, javascript, js framework, frontend, ui toolkit, widgets, mvc, spa, web apps, modular js, amd, dojo logo, developer tools, ajax, dom, templating, animation, open source, brand - Devicons - DiDojo - SVG | WEBP | PNG | JPG - Icon free download
DiDojo
dotnet, .net, microsoft, framework, runtime, backend, aspnet, csharp, clr, developer platform, cross platform, web apps, api, microservices, enterprise apps, cloud, azure, compilation, open source, brand - Devicons - DiDotnet - SVG | WEBP | PNG | JPG - Icon free download
DiDotnet
dreamweaver, adobe dreamweaver, editor, web editor, html, css, frontend, design, web design, site builder, templates, layout, developer tools, adobe, creative cloud, wysiwyg, file management, publishing, brand - Devicons - DiDreamweaver - SVG | WEBP | PNG | JPG - Icon free download
DiDreamweaver
dropbox, cloud storage, file sync, file sharing, backup, collaboration, team folders, documents, cloud, storage service, drive, upload, download, workspace, productivity, remote work, sharing platform, security, brand - Devicons - DiDropbox - SVG | WEBP | PNG | JPG - Icon free download
DiDropbox
drupal, drupal cms, drupal logo, cms, content management, web platform, open source, php cms, website builder, framework, backend, frontend, web development, theme, module, plugin, site building, enterprise, developer tools, branding - Devicons - DiDrupal - SVG | WEBP | PNG | JPG - Icon free download
DiDrupal
envato, envato logo, themeforest, codecanyon, marketplace, templates, assets, creative market, design resources, stock media, plugins, themes, digital products, brand, ecommerce, ui kits, graphics, developer tools - Devicons - DiEnvato - SVG | WEBP | PNG | JPG - Icon free download
DiEnvato
firefox, mozilla firefox, browser, web browser, mozilla, open source, internet, privacy browser, secure browsing, cross platform, developer tools, responsive design mode, fox logo, brand, software, surfing, web navigation - Devicons - DiFirefox - SVG | WEBP | PNG | JPG - Icon free download
DiFirefox
ghost, ghost cms, blog, blogging, publishing, markdown, cms platform, content platform, web app, brand, logo, developer tools, open source, platform, writing, editor, static site, theme, dashboard, website, frontend, backend - Devicons - DiGhost - SVG | WEBP | PNG | JPG - Icon free download
DiGhost
git, brand, git logo, version control, source control, repository, developer tools, vcs, github, gitlab, bitbucket, open source, code workflow, cli, branching, merging - Devicons - DiGit - SVG | WEBP | PNG | JPG - Icon free download
DiGit
github, github alt, brand, logo, octocat, source control, repository, vcs, developer community, open source, profile, organization, developer tools, code hosting, collaboration, issues, pull requests - Devicons - DiGithubAlt - SVG | WEBP | PNG | JPG - Icon free download
DiGithubAlt
github, github badge, badge, logo, brand, octocat, repository, open source, vcs, developer tools, profile badge, status badge, code hosting, collaboration, community - Devicons - DiGithubBadge - SVG | WEBP | PNG | JPG - Icon free download
DiGithubBadge
github, github full, brand, logo, full logo, octocat, repository, source control, vcs, developer tools, open source, community, code hosting, integration, profile - Devicons - DiGithubFull - SVG | WEBP | PNG | JPG - Icon free download
DiGithubFull
github, brand, repo, repository, git, version control, source code, code hosting, open source, developer, devops, ci cd, commit, push, pull request, merge, branch, issue tracker, collaboration, team, workflow, platform, hosting, web, cloud, integration, automation, api, cli, desktop app, organization, project, management, dashboard, toolbar, header, footer, nav, sidebar - Devicons - DiGithub - SVG | WEBP | PNG | JPG - Icon free download
DiGithub
gnu, brand, linux, open source, free software, fsf, operating system, os, toolchain, compiler, gcc, bash, shell, cli, kernel, unix, permissions, system administration, infrastructure, developer, package, environment, license, community, foundation, ecosystem, platform - Devicons - DiGnu - SVG | WEBP | PNG | JPG - Icon free download
DiGnu
go, golang, brand, programming language, backend, api, microservices, concurrency, goroutines, compiler, binary, cli, web server, framework, sdk, tooling, devops, cloud native, kubernetes, docker, fast, scalable, efficient, performant, developer, engineer, platform - Devicons - DiGo - SVG | WEBP | PNG | JPG - Icon free download
DiGo
google analytics, ga, analytics, tracking, metrics, data, dashboard, charts, conversion, traffic, events, behavior, funnels, audience, web analytics, measurement, performance, reports, marketing, seo, ppc, insights, optimisation, tracking code, tag manager, platform, brand - Devicons - DiGoogleAnalytics - SVG | WEBP | PNG | JPG - Icon free download
DiGoogleAnalytics
google drive, drive, cloud storage, file storage, documents, sheets, slides, collaboration, sharing, backup, sync, workspace, folders, upload, download, file manager, brand, cloud, productivity, team, organization, web app, office suite - Devicons - DiGoogleDrive - SVG | WEBP | PNG | JPG - Icon free download
DiGoogleDrive
google cloud, gcp, cloud platform, compute engine, kubernetes, gke, cloud run, cloud functions, bigquery, storage, vpc, iam, devops, infrastructure, scaling, networking, containers, serverless, deployment, automation, monitoring, observability, brand, platform, api, sdk - Devicons - DiGoogleCloudPlatform - SVG | WEBP | PNG | JPG - Icon free download
DiGoogleCloudPlatform
grails, groovy grails, framework, mvc, backend, web framework, rapid development, scaffolding, orm, gsp, grails app, plugin, api, crud, server, developer, enterprise, rest, tooling, build, project, platform, brand - Devicons - DiGrails - SVG | WEBP | PNG | JPG - Icon free download
DiGrails
groovy, language, scripting, jvm, java, gradle, grails, dsl, backend, automation, scripts, build tools, compiler, interpreter, developer, api, framework, rapid development, tooling, ecosystem, brand - Devicons - DiGroovy - SVG | WEBP | PNG | JPG - Icon free download
DiGroovy
grunt, task runner, automation, frontend, build, minify, uglify, compile, sass, less, bundle, workflow, cli, npm, scripts, developer, tooling, assets, optimization, project, brand - Devicons - DiGrunt - SVG | WEBP | PNG | JPG - Icon free download
DiGrunt
gulp, task runner, automation, pipeline, frontend, minify, uglify, sass, less, build, bundle, workflow, cli, npm, tooling, developer, assets, optimization, stream, project, brand - Devicons - DiGulp - SVG | WEBP | PNG | JPG - Icon free download
DiGulp
hackernews, hn, news, tech news, developer news, programming news, community, blog, discussion, feed, aggregator, open source, brand, logo, social platform, tech community, sidebar link, header link, navigation - Devicons - DiHackernews - SVG | WEBP | PNG | JPG - Icon free download
DiHackernews
haskell, functional programming, fp, lambda, code, backend, compiler, ghc, dev, programming language, logo, brand, syntax, developer tools, learning, academic, type system, server side, footer logo - Devicons - DiHaskell - SVG | WEBP | PNG | JPG - Icon free download
DiHaskell
heroku, cloud platform, paas, deployment, hosting, server, buildpacks, apps, scaling, devops, runtime, backend hosting, developer, brand, logo, cloud deploy, infrastructure, dashboard link - Devicons - DiHeroku - SVG | WEBP | PNG | JPG - Icon free download
DiHeroku
html5, 3d, 3d effects, webgl, css effects, frontend, browser, animation, graphics, visual effects, ui, web design, developer, brand, logo, interactive, multimedia, renderer - Devicons - DiHtml53dEffects - SVG | WEBP | PNG | JPG - Icon free download
DiHtml53dEffects
html5, connectivity, network, websocket, api, frontend, browser, communication, offline mode, service worker, dev, developer tools, logo, brand, web apps, modern web, pwa - Devicons - DiHtml5Connectivity - SVG | WEBP | PNG | JPG - Icon free download
DiHtml5Connectivity
html5, device access, camera, microphone, sensors, browser api, web platform, permissions, user media, frontend, developer, brand, logo, hardware access, mobile web, pwa - Devicons - DiHtml5DeviceAccess - SVG | WEBP | PNG | JPG - Icon free download
DiHtml5DeviceAccess
html5, multimedia, audio, video, media api, streaming, player, frontend, browser tech, web apps, dev, developer tools, logo, brand, interactive, content - Devicons - DiHtml5Multimedia - SVG | WEBP | PNG | JPG - Icon free download
DiHtml5Multimedia
html5, html, frontend, css, javascript, browser, markup, web standard, web design, developer, brand, logo, ui, framework, pwa, modern web, responsive, layout - Devicons - DiHtml5 - SVG | WEBP | PNG | JPG - Icon free download
DiHtml5
ie, internet explorer, browser, legacy browser, microsoft, web, frontend, compatibility, legacy support, developer, brand, logo, old browser, edge transition, testing - Devicons - DiIe - SVG | WEBP | PNG | JPG - Icon free download
DiIe
illustrator, adobe illustrator, vector, graphics, design, logo, brand, ai file, drawing, editing, illustration, creative cloud, designer tools, digital art, icon design, mockups, ui assets - Devicons - DiIllustrator - SVG | WEBP | PNG | JPG - Icon free download
DiIllustrator
intellij, jetbrains, intellij idea, ide, code editor, java ide, developer tool, programming, coding, backend, frontend, workspace, editor, syntax, project, refactor, debug, android, android development, enterprise, build tool, code intelligence, productivity, software, dev environment, developer workflow, devops - Devicons - DiIntellij - SVG | WEBP | PNG | JPG - Icon free download
DiIntellij
jenkins, ci, cd, continuous integration, continuous delivery, automation, pipeline, devops, build server, deploy, testing, workflow, orchestration, infrastructure, plugins, scripts, jobs, automation server, software delivery, enterprise, team workflow, quality assurance - Devicons - DiJenkins - SVG | WEBP | PNG | JPG - Icon free download
DiJenkins
jira, atlassian, project management, scrum, agile, kanban, tickets, issues, backlog, sprint, workflow, devops, collaboration, team board, product planning, task tracking, work items, epic, story, bug tracking, enterprise, productivity, dashboard - Devicons - DiJira - SVG | WEBP | PNG | JPG - Icon free download
DiJira
jquery, jquery ui, jqueryui, jquery ui logo, javascript library, ui toolkit, frontend, widgets, interactions, draggable, sortable, tabs, accordion, dialog, web components, ui components, web design, frontend dev, developer tools, ecosystem, brand - Devicons - DiJqueryUiLogo - SVG | WEBP | PNG | JPG - Icon free download
DiJqueryUiLogo
js, javascript, javascript badge, js logo, badge, language badge, frontend, ecmascript, coding, webdev, node, browser scripting, programming language, dev badge, tech stack, brand - Devicons - DiJsBadge - SVG | WEBP | PNG | JPG - Icon free download
DiJsBadge
komodo, komodo ide, komodo edit, ide, code editor, editor, programming tools, software, developer tools, workflow, debugging, coding environment, brand, tech stack, utilities - Devicons - DiKomodo - SVG | WEBP | PNG | JPG - Icon free download
DiKomodo
krakenjs, krakenjs badge, kraken, express extension, javascript framework, node framework, backend, server framework, api, middleware, badge, brand, tech logo, webdev, nodejs ecosystem - Devicons - DiKrakenjsBadge - SVG | WEBP | PNG | JPG - Icon free download
DiKrakenjsBadge
krakenjs, kraken, javascript framework, node framework, backend, api framework, server routing, middleware, webdev, nodejs, ecosystem, brand, tech - Devicons - DiKrakenjs - SVG | WEBP | PNG | JPG - Icon free download
DiKrakenjs
laravel, php framework, mvc, eloquent, artisan, blade, php, backend, web framework, server side, routing, api, orm, dev stack, brand, ecosystem - Devicons - DiLaravel - SVG | WEBP | PNG | JPG - Icon free download
DiLaravel
less, lesscss, css preprocessor, preprocessor, stylesheets, variables, mixins, frontend, styling, web design, theming, css tooling, developer tools, brand - Devicons - DiLess - SVG | WEBP | PNG | JPG - Icon free download
DiLess
linux, tux, os, operating system, kernel, open source, unix, terminal, cli, server, sysadmin, devops, infrastructure, containers, vm, brand - Devicons - DiLinux - SVG | WEBP | PNG | JPG - Icon free download
DiLinux
magento, adobe commerce, ecommerce, storefront, online store, cms, catalog, cart, checkout, payment, extension, plugin, php platform, merchant tools, brand, ecommerce platform - Devicons - DiMagento - SVG | WEBP | PNG | JPG - Icon free download
DiMagento
mailchimp, email marketing, automation, campaigns, newsletter, crm, audience management, segmentation, email tools, brand, chimp logo, marketing platform, customer engagement, templates, analytics - Devicons - DiMailchimp - SVG | WEBP | PNG | JPG - Icon free download
DiMailchimp
mozilla, firefox, browser, open source, foundation, internet, web tools, developer, html5, css3, standards, community, security, privacy, branding - Devicons - DiMozilla - SVG | WEBP | PNG | JPG - Icon free download
DiMozilla
openshift, open shift, red hat, cloud platform, kubernetes, containers, paas, devops, orchestration, cluster, infrastructure, automation, deployment, ci cd, enterprise cloud, server management, developer tools, backend, microservices, hosting, cluster ops, platform engineering, branding, logo - Devicons - DiOpenshift - SVG | WEBP | PNG | JPG - Icon free download
DiOpenshift
open source, opensource, oss, community, free software, collaboration, git, version control, packages, libraries, frameworks, developer tools, coding, repository, contribute, license, github, projects, dev community, branding, logo - Devicons - DiOpensource - SVG | WEBP | PNG | JPG - Icon free download
DiOpensource
opera, browser, web browser, internet, navigation, web access, tabs, search, ui, mobile browser, desktop browser, software, developer tools, testing, cross browser, compatibility, performance, network, branding, logo - Devicons - DiOpera - SVG | WEBP | PNG | JPG - Icon free download
DiOpera
perl, programming, script, scripting, backend, cli, automation, text processing, regex, developer tools, languages, unix, linux, server scripts, system tasks, legacy systems, coding, opensource, branding, logo - Devicons - DiPerl - SVG | WEBP | PNG | JPG - Icon free download
DiPerl
phonegap, cordova, hybrid apps, mobile apps, cross platform, javascript apps, framework, app builder, mobile development, ui, android, ios, frontend, backend, plugins, deployment, developer tools, branding, logo - Devicons - DiPhonegap - SVG | WEBP | PNG | JPG - Icon free download
DiPhonegap
photoshop, ps, adobe, image editing, photo editing, graphic design, layers, retouch, ui design, mockups, digital art, illustration, composition, filters, color correction, creative tools, designer workflow, branding, logo - Devicons - DiPhotoshop - SVG | WEBP | PNG | JPG - Icon free download
DiPhotoshop
php, backend, server side, web development, programming, scripting, lamp stack, mysql, apache, cms, wordpress, joomla, drupal, framework, laravel, symfony, developer tools, backend engineering, opensource, branding, logo - Devicons - DiPhp - SVG | WEBP | PNG | JPG - Icon free download
DiPhp
postgresql, postgres, database, db, sql, rdbms, open source, structured data, backend, queries, developer tools, data storage, indexing, transactions, scalability, server, analytics, data ops, infrastructure, branding, logo - Devicons - DiPostgresql - SVG | WEBP | PNG | JPG - Icon free download
DiPostgresql
prolog, logic programming, ai, inference engine, rules engine, research, academic, backend, knowledge base, constraints, developer tools, languages, symbolic ai, automation, data modeling, opensource, branding, logo - Devicons - DiProlog - SVG | WEBP | PNG | JPG - Icon free download
DiProlog
python, programming, backend, scripting, automation, data science, machine learning, ai, deep learning, pandas, django, flask, fastapi, developer tools, analysis, ml ops, cli, frontend backend, opensource, branding, logo - Devicons - DiPython - SVG | WEBP | PNG | JPG - Icon free download
DiPython
rackspace, cloud, hosting, server provider, devops, infrastructure, saas, iaas, managed hosting, deployment, platform, backend, sysadmin, cluster, scalable hosting, service provider, linux hosting, enterprise cloud, datacenter, ops, automation, api, web hosting, backend services, hosting dashboard - Devicons - DiRackspace - SVG | WEBP | PNG | JPG - Icon free download
DiRackspace
red hat, redhat, rhel, linux, enterprise linux, open source, server os, rpm, sysadmin, devops, cloud, virtualization, security, infrastructure, enterprise, os distribution, containerization, kubernetes ecosystem, fedora related, linux server, it ops, deployment, data center, admin tools - Devicons - DiRedhat - SVG | WEBP | PNG | JPG - Icon free download
DiRedhat
ruby, ruby language, ruby logo, programming, backend, scripting, rails, ruby on rails, ror, compiler, interpreter, oop, backend dev, api, webdev, server side, developer tool, code, software, framework, icon, brand - Devicons - DiRuby - SVG | WEBP | PNG | JPG - Icon free download
DiRuby
rust, rust logo, rust lang, systems programming, memory safety, low level, backend, compiler, cargo, rustc, fast code, safe code, multithreading, concurrency, cli tools, webassembly, wasm, performance, developer tool, brand - Devicons - DiRust - SVG | WEBP | PNG | JPG - Icon free download
DiRust
safari, safari browser, apple browser, web browser, macos, ios, explorer, navigation, internet, web app, ui, ux, mobile, desktop, cross platform, web navigation, browser icon, bookmark, tab, brand - Devicons - DiSafari - SVG | WEBP | PNG | JPG - Icon free download
DiSafari
sass, scss, sass logo, css preprocessor, frontend, styling, design, theming, variables, mixins, ui design, webdev, compiler, style sheet, styling engine, css enhancement, brand, developer tool, component styling - Devicons - DiSass - SVG | WEBP | PNG | JPG - Icon free download
DiSass
scala, scala language, scala logo, functional programming, fp, oop, jvm, java interoperability, backend, akka, spark, big data, distributed systems, api dev, developer tool, typed language, code, software engineering, brand - Devicons - DiScala - SVG | WEBP | PNG | JPG - Icon free download
DiScala
scriptcs, c sharp scripting, c# scripting, script cs logo, dotnet scripting, csharp, scripting engine, runtime, cli, automation, dev tools, quick scripts, prototype code, dotnet, coding, compiler, interpreter, brand - Devicons - DiScriptcs - SVG | WEBP | PNG | JPG - Icon free download
DiScriptcs
scrum, scrum logo, agile, project management, sprint, kanban, team workflow, collaboration, planning, standup, backlog, retrospective, product owner, scrum master, development process, workflow tool, brand - Devicons - DiScrum - SVG | WEBP | PNG | JPG - Icon free download
DiScrum
sencha touch, sencha, touch ui, mobile ui, javascript framework, frontend, hybrid apps, ux, design system, components, cordova, phonegap, enterprise apps, developer tool, brand, ui toolkit, mobile dev - Devicons - DiSenchatouch - SVG | WEBP | PNG | JPG - Icon free download
DiSenchatouch
sizzle, sizzle js, selector engine, javascript, dom engine, jquery core, query selector, frontend, webdev, js library, dom parsing, developer tool, performance, selectors, utility library, brand - Devicons - DiSizzlejs - SVG | WEBP | PNG | JPG - Icon free download
DiSizzlejs
smashing magazine, smashingmag, design magazine, web design, frontend, development blog, ui ux, articles, tutorials, learning, education, news, resources, creative, developer resource, brand - Devicons - DiSmashingMagazine - SVG | WEBP | PNG | JPG - Icon free download
DiSmashingMagazine
symfony, symfony badge, php framework, backend, mvc, composer, routing, api, server side, web development, developer tool, backend engine, php ecosystem, framework logo, badge style, documentation, dependencies, module system, enterprise, scalable apps - Devicons - DiSymfonyBadge - SVG | WEBP | PNG | JPG - Icon free download
DiSymfonyBadge
techcrunch, brand, logo, news site, tech media, startup news, technology blog, magazine, press, publication, editorial, website logo, media brand, news platform, tech journalism, header logo, footer logo, sidebar logo, navigation, brand icon - Devicons - DiTechcrunch - SVG | WEBP | PNG | JPG - Icon free download
DiTechcrunch
terminal, badge, shell, cli, command line, console, prompt, developer tools, coding, programming, script, automation, devops, sysadmin, build tools, compile, run command, debug, linux tools, macos terminal, windows terminal, developer badge, status badge, deployment - Devicons - DiTerminalBadge - SVG | WEBP | PNG | JPG - Icon free download
DiTerminalBadge
travis, travis ci, brand, logo, ci, cd, continuous integration, continuous delivery, pipeline, automation, build, test, deploy, devops, developer tools, workflow, infrastructure, service logo, cloud workflow, github actions alternative - Devicons - DiTravis - SVG | WEBP | PNG | JPG - Icon free download
DiTravis
trello, brand, logo, kanban, board, task, task management, project management, collaboration, workflow, productivity, team work, cards, lists, scrum, agile, planning, tracker, tool logo, dashboard - Devicons - DiTrello - SVG | WEBP | PNG | JPG - Icon free download
DiTrello
typo3, brand, logo, cms, content management, website, web platform, php cms, enterprise cms, publishing, editorial, web development, backend, frontend, framework, template system, web builder, content editing, organization - Devicons - DiTypo3 - SVG | WEBP | PNG | JPG - Icon free download
DiTypo3
ubuntu, linux, linux distro, os, operating system, brand, logo, open source, developer environment, server, infrastructure, terminal, devops, sysadmin, cloud, vm, desktop environment, canonical, package manager, bash - Devicons - DiUbuntu - SVG | WEBP | PNG | JPG - Icon free download
DiUbuntu
uikit, ui kit, brand, logo, framework, frontend, components, css framework, web design, ui library, responsive design, theme, interface elements, component system, design system, layout tools, developer tools, web toolkit - Devicons - DiUikit - SVG | WEBP | PNG | JPG - Icon free download
DiUikit
unity, unity small, brand, logo, game engine, gaming, 3d, developer tools, game dev, asset creation, rendering, animation, vr, ar, mobile games, desktop games, engine logo, workflow, editor, design tools - Devicons - DiUnitySmall - SVG | WEBP | PNG | JPG - Icon free download
DiUnitySmall
vim, brand, logo, editor, text editor, developer tools, terminal editor, cli editor, neovim, coding, programming, open source, keyboard driven, efficiency, modal editing, linux, macos, windows, developer workflow - Devicons - DiVim - SVG | WEBP | PNG | JPG - Icon free download
DiVim
windows, microsoft, os, desktop os, win10, win11, pc, system ui, computer, platform, exe, installer, start menu, device, environment, enterprise, software platform, system setting - Devicons - DiWindows - SVG | WEBP | PNG | JPG - Icon free download
DiWindows
yahoo, yahoo small, brand, search engine, email provider, ymail, portal, news, finance, messenger, legacy web, service platform, internet brand, landing header, footer icon - Devicons - DiYahooSmall - SVG | WEBP | PNG | JPG - Icon free download
DiYahooSmall
yahoo, brand logo, search engine, email, ymail, news portal, finance, sports, messenger, internet brand, legacy web, provider, identity, header link, footer link - Devicons - DiYahoo - SVG | WEBP | PNG | JPG - Icon free download
DiYahoo
500px, photo platform, photography, photo sharing, portfolio, creative community, brand, logo, social media, camera, gallery, images, visual art, photographer, nav, footer logo, header logo, button, icon pack - Font Awesome 5 - Fa500Px - SVG | WEBP | PNG | JPG - Icon free download
Fa500Px
accusoft, brand, logo, software, enterprise, ocr, document processing, pdf, cloud tools, api, developer tools, conversion, digital workflow, automation, tech, saas, vendor - Font Awesome 5 - FaAccusoft - SVG | WEBP | PNG | JPG - Icon free download
FaAccusoft
acquisitions incorporated, ai, dnd, dungeons and dragons, tabletop, rpg, gaming, fantasy, brand, logo, podcast, livestream, community, adventure, entertainment, geek culture - Font Awesome 5 - FaAcquisitionsIncorporated - SVG | WEBP | PNG | JPG - Icon free download
FaAcquisitionsIncorporated
adn, app dot net, social network, microblogging, communication, brand, logo, messaging, timeline, community, developer platform, api, social media, tech - Font Awesome 5 - FaAdn - SVG | WEBP | PNG | JPG - Icon free download
FaAdn
adversal, ad network, advertising, marketing, brand, logo, adtech, publisher, monetization, traffic, campaigns, display ads, programmatic, media, digital marketing - Font Awesome 5 - FaAdversal - SVG | WEBP | PNG | JPG - Icon free download
FaAdversal
affiliatetheme, affiliate, theme, wordpress, ecommerce, blogging, affiliate marketing, brand, logo, monetization, seo, publisher, content marketing, affiliate tools, ads, conversion - Font Awesome 5 - FaAffiliatetheme - SVG | WEBP | PNG | JPG - Icon free download
FaAffiliatetheme
airbnb, lodging, stay, travel, rental, vacation home, host, booking, brand, logo, hospitality, bnb, accommodation, property, guest, tourism, platform - Font Awesome 5 - FaAirbnb - SVG | WEBP | PNG | JPG - Icon free download
FaAirbnb
algolia, search, search engine, api, developer, brand, logo, saas, cloud search, instant search, query, indexing, site search, autocomplete, tech, frontend - Font Awesome 5 - FaAlgolia - SVG | WEBP | PNG | JPG - Icon free download
FaAlgolia
alipay, payment, wallet, china, alibaba, pay, brand, logo, ecommerce, checkout, qr pay, finance, transactions, mobile payment, digital wallet, billing, secure pay - Font Awesome 5 - FaAlipay - SVG | WEBP | PNG | JPG - Icon free download
FaAlipay
amazon pay, amazon, pay, payment, checkout, wallet, billing, online payment, ecommerce, transaction, upi, credit card, debit card, gateway, amazon wallet, shopping, pay online, brand, logo, button, header, footer, navbar, cta, digital wallet, merchant - Font Awesome 5 - FaAmazonPay - SVG | WEBP | PNG | JPG - Icon free download
FaAmazonPay
amazon, shopping, ecommerce, marketplace, amazon logo, brand, store, online store, prime, retail, cart, search, product, buy, sell, delivery, logo, navbar, footer, menu, cta, brand mark, global brand - Font Awesome 5 - FaAmazon - SVG | WEBP | PNG | JPG - Icon free download
FaAmazon
amilia, brand, logo, community, network, platform, startup, social, collaboration, team, group, identity, social platform, navbar, header, footer, menu icon - Font Awesome 5 - FaAmilia - SVG | WEBP | PNG | JPG - Icon free download
FaAmilia
android, google android, robot, os, mobile, smartphone, app, apk, development, android developer, play store, material, logo, brand, platform, device, software, tech, ui, widget, navbar, footer, badge - Font Awesome 5 - FaAndroid - SVG | WEBP | PNG | JPG - Icon free download
FaAndroid
angellist, angel list, startup, investor, funding, venture capital, vc, business, founder, entrepreneur, network, social platform, logo, brand, jobs, recruit, hire, team, company profile, navbar, footer, share - Font Awesome 5 - FaAngellist - SVG | WEBP | PNG | JPG - Icon free download
FaAngellist
angry creative, agency, design, creative, studio, branding, web agency, logo, brand, wordpress, development, marketing, identity, graphics, team, portfolio, navbar, footer - Font Awesome 5 - FaAngrycreative - SVG | WEBP | PNG | JPG - Icon free download
FaAngrycreative
angular, angularjs, framework, frontend, typescript, web development, spa, javascript, developer, coding, ui framework, material, logo, brand, tech, programming, webpack, router, component, cli - Font Awesome 5 - FaAngular - SVG | WEBP | PNG | JPG - Icon free download
FaAngular
app store ios, apple, ios, download, install, mobile app, iphone, ipad, store badge, application, apple store, device, software, brand, logo, cta, button, header, landing page - Font Awesome 5 - FaAppStoreIos - SVG | WEBP | PNG | JPG - Icon free download
FaAppStoreIos
app store, store, app marketplace, download, install, mobile, ios, mac, apple, software, brand, logo, application, cta button, badge, store link, navbar, footer - Font Awesome 5 - FaAppStore - SVG | WEBP | PNG | JPG - Icon free download
FaAppStore
apper, app platform, brand, logo, mobile, technology, startup, dev tool, app builder, software, ui, team, navbar, footer, badge, identity, platform - Font Awesome 5 - FaApper - SVG | WEBP | PNG | JPG - Icon free download
FaApper
apple pay, apple, pay, payment, wallet, checkout, mobile pay, contactless, tap to pay, digital wallet, ecommerce, financial, ios, iphone, ipad, brand icon, store, purchase, transaction, online payment, secure pay, badge, button - Font Awesome 5 - FaApplePay - SVG | WEBP | PNG | JPG - Icon free download
FaApplePay
apple, brand, logo, mac, macbook, iphone, ipad, ios, macos, tech company, technology, electronics, hardware, software, branding, mobile, desktop, store, ecosystem, iconic logo, button, badge - Font Awesome 5 - FaApple - SVG | WEBP | PNG | JPG - Icon free download
FaApple
artstation, art, digital art, 3d modeling, artists, portfolio, creative community, game art, concept art, illustration, design, branding, media, creative software, gallery, showcase, designer platform, button, profile, badge - Font Awesome 5 - FaArtstation - SVG | WEBP | PNG | JPG - Icon free download
FaArtstation
asymmetrik, brand, tech company, enterprise, data, analytics, security, software, solutions, development, branding, logo, platform, api, integration, business, professional services, badge, button - Font Awesome 5 - FaAsymmetrik - SVG | WEBP | PNG | JPG - Icon free download
FaAsymmetrik
atlassian, jira, confluence, bitbucket, trello, collaboration, productivity, project management, devops, software development, workflow, teamwork, branding, enterprise, saas, tools, platform, organization, badge, logo - Font Awesome 5 - FaAtlassian - SVG | WEBP | PNG | JPG - Icon free download
FaAtlassian
audible, audiobooks, audio, books, podcasts, listening, streaming, media, entertainment, amazon, subscription, audio app, brand icon, sound, library, digital content, storytelling, badge, button - Font Awesome 5 - FaAudible - SVG | WEBP | PNG | JPG - Icon free download
FaAudible
autoprefixer, css, frontend, tool, postcss, web development, browser prefixes, automation, style processing, build tools, developer tool, branding, workflow, code, compiler, badge, button - Font Awesome 5 - FaAutoprefixer - SVG | WEBP | PNG | JPG - Icon free download
FaAutoprefixer
avianex, airline, flight, air travel, aviation, booking, airport, travel, transportation, brand, logo, ticketing, journey, trip, flight service, badge, button - Font Awesome 5 - FaAvianex - SVG | WEBP | PNG | JPG - Icon free download
FaAvianex
aviato, brand, startup, tech company, fictional brand, marketing, logo, business, platform, community, identity, badge, symbol, button - Font Awesome 5 - FaAviato - SVG | WEBP | PNG | JPG - Icon free download
FaAviato
aws, amazon web services, cloud, hosting, server, infrastructure, lambda, s3, ec2, rds, dynamodb, api, devops, scaling, deployment, cloud computing, backend, platform, saas, enterprise, badge, logo - Font Awesome 5 - FaAws - SVG | WEBP | PNG | JPG - Icon free download
FaAws
bandcamp, brand, music, audio, streaming, artist platform, indie music, album, song, playlist, media, entertainment, publisher, creative, upload, share, digital store, badge, logo, icon, web, app, social media - Font Awesome 5 - FaBandcamp - SVG | WEBP | PNG | JPG - Icon free download
FaBandcamp
battlenet, brand, gaming, blizzard, game launcher, account, multiplayer, esports, pc gaming, launcher, profile, login, online play, friends, network, badge, logo, blizzard app, authentication, gamer community - Font Awesome 5 - FaBattleNet - SVG | WEBP | PNG | JPG - Icon free download
FaBattleNet
behance, behance square, brand, design, portfolio, creative work, designer, ui, ux, case study, project showcase, art, illustration, graphic design, badge, logo, social platform, dribbble alternative, profile, square icon - Font Awesome 5 - FaBehanceSquare - SVG | WEBP | PNG | JPG - Icon free download
FaBehanceSquare
behance, brand, design, portfolio, creative, graphic design, ui, ux, illustration, case study, project, profile, dribbble alt, designer hub, logo, badge, social link, creative showcase, artwork - Font Awesome 5 - FaBehance - SVG | WEBP | PNG | JPG - Icon free download
FaBehance
bimobject, brand, architecture, construction, engineering, bim, 3d models, cad, planning, building, assets, specification, product libraries, architect tools, interior design, logo, badge, platform - Font Awesome 5 - FaBimobject - SVG | WEBP | PNG | JPG - Icon free download
FaBimobject
bitbucket, brand, git, repo, repository, atlassian, version control, code hosting, devops, pull request, developer, team collaboration, ci cd, pipeline, source control, project, badge, logo, integration, vcs - Font Awesome 5 - FaBitbucket - SVG | WEBP | PNG | JPG - Icon free download
FaBitbucket
bitcoin, btc, crypto, cryptocurrency, brand, coin, token, blockchain, wallet, exchange, mining, trading, payment, digital currency, market, invest, finance, ledger, defi, logo, badge - Font Awesome 5 - FaBitcoin - SVG | WEBP | PNG | JPG - Icon free download
FaBitcoin
bity, brand, social, media, platform, profile, logo, badge, communication, messaging, creator, community, content, digital, network, web, app - Font Awesome 5 - FaBity - SVG | WEBP | PNG | JPG - Icon free download
FaBity
black tie, brand, formal, tuxedo, bowtie, fashion, style, luxury, event, dress code, elegant, attire, accessory, logo, badge, premium, gala, suit, menswear - Font Awesome 5 - FaBlackTie - SVG | WEBP | PNG | JPG - Icon free download
FaBlackTie
blackberry, brand, mobile, phone, device, enterprise, security, messaging, bbm, smartphone, corporate, platform, logo, badge, communication, email, business phone, legacy device, tech - Font Awesome 5 - FaBlackberry - SVG | WEBP | PNG | JPG - Icon free download
FaBlackberry
Tags
brandbadgeuilogodevicemobileoutlinemessagefilledwebcommunicationhardwaresocialsecuritychatbuttonemaillabelbootstrapmediatechplatformsquaretoolbarindicatorcirclephonesymbolmaildevelopersendandroiddigitioscommunityprofilecallnetworkheadersharecontactmessagingvideotagbackendinboxalertfrontendscreencomputerprivacystatusicondeveloper toolsdesignenvelopesidebarstorageshieldprotectionnavigationgamingmarkernumbersoftwaredashboardnotificationsupportstepaudioaccesselectronicsdisplaydevopsofficeautomationsystemserverpcreplywarningsettingsbrandingstoreeditordesktopmonitorblockuxmenureact-iconsgooglesmartphonefooterinternetcodedocumentcommentcollaborationcodinginfrastructureappopen sourcelayoutbrowsertelephoneprogrammingconversationstreamingcloudidentitycarddataarrowapimarketingentertainmentsecureletterframeworkenterprisecamerarestrictedconnectorcableecommercesearchsafesignalinputchipinterfaceportfolioworkspaceunlockcontentbubbleusbauthenticationerroriotosmusicopenxthreadworkflowcounterpaymenttechnologymicrosoftlockauthdialmarkchargingpowerdisabledforwardblockedconnectivityshapeinteractionsocial mediastickerpostnavigatepaginationminimalworkresponsiveportawardsoundpluscountclivoicecheckteamconnectwirelessforbiddenqualitysuccessslashperformancetoggleproductivityfinancechinaverifieddeploymentloginbusinessachievementsubmitoutgoingremovehostingroundnavbartoolworkstationtelecomdiskaddenergydrivebackupcompileralphabetheartuploadtokenpanelappleblogtabletcreativerepositorycorporatepointer3dinitialtransfercanceliocheckoutresolutionstop